KEGG   Homo sapiens (human): 55515Help
Entry
55515             CDS       T01001                                 

Gene name
ASIC4, ACCN4, BNAC4
Definition
(RefSeq) acid sensing ion channel subunit family member 4
  KO
K04831  acid-sensing ion channel 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    55515 (ASIC4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    55515 (ASIC4)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   55515 (ASIC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ASC
Motif
Other DBs
NCBI-GeneID: 55515
NCBI-ProteinID: NP_878267
OMIM: 606715
HGNC: 21263
Ensembl: ENSG00000072182
Vega: OTTHUMG00000058928
Pharos: Q96FT7(Tbio)
UniProt: Q96FT7
Position
2q35
AA seq 647 aa AA seqDB search
MLSGAAGAARRGGAALAPSLTRSLAGTHAGADSCAGADKGSHKETIEERDKRQQRQQRQR
QHQGCGAAGSGSDSPTSGPHPVPVLFPLALSLEEQPLPPLPLGRAPGLLAREGQGREALA
SPSSRGQMPIEIVCKIKFAEEDAKPKEKEAGDEQSLLGAVAPGAAPRDLATFASTSTLHG
LGRACGPGPHGLRRTLWALALLTSLAAFLYQAAGLARGYLTRPHLVAMDPAAPAPVAGFP
AVTLCNINRFRHSALSDADIFHLANLTGLPPKDRDGHRAAGLRYPEPDMVDILNRTGHQL
ADMLKSCNFSGHHCSASNFSVVYTRYGKCYTFNADPRSSLPSRAGGMGSGLEIMLDIQQE
EYLPIWRETNETSFEAGIRVQIHSQEEPPYIHQLGFGVSPGFQTFVSCQEQRLTYLPQPW
GNCRAESELREPELQGYSAYSVSACRLRCEKEAVLQRCHCRMVHMPDSLGGGPEGPCFCP
TPCNLTRYGKEISMVRIPNRGSARYLARKYNRNETYIRENFLVLDVFFEALTSEAMEQRA
AYGLSALLGDLGGQMGLFIGASILTLLEILDYIYEVSWDRLKRVWRRPKTPLRTSTGGIS
TLGLQELKEQSPCPSRGRVEGGGVSSLLPNHHHPHGPPGGLFEDFAC
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgctgagcggagcggctggggctgcgcggcgtggcggagcagcgctcgctccctcgctc
actcgctcgctcgcagggacacacgcaggggctgacagctgtgctggtgctgataaggga
agccacaaggagacgatcgaggagagagacaagcggcagcagaggcagcagcggcagagg
cagcaccagggctgcggagctgctgggagtgggagtgactcccccacctcgggcccccac
cctgtccctgtcctcttcccgcttgccctgagtttagaagagcagccgctgccaccactg
ccactcgggagggcaccagggctgctggctagggagggacagggcagggaggctctggcc
agtcccagcagccggggacagatgccgatcgagattgtgtgcaaaatcaaatttgctgag
gaggatgcgaaacccaaggagaaggaggcaggggatgagcagagcctcctcggggctgtt
gcccctggagcagccccccgagacctggccacctttgccagcaccagcaccctgcatgga
ctgggccgggcctgtggcccaggcccccacggactgcgcagaaccctgtgggcactggcc
ctactcacctcgctggctgccttcctgtaccaggcggctggcctggcccggggctacctg
acccggcctcacctggtggcaatggaccccgctgccccagccccagtggcgggcttcccg
gctgtcaccctctgcaatatcaaccgcttccggcattcggcactcagcgatgccgacatc
ttccacctggccaatctgacagggctgccccccaaagaccgggatgggcaccgtgcggct
ggcctgcgctacccagagcctgacatggtagacatcctcaaccgcactggccaccagctc
gccgacatgcttaagagctgcaacttcagtgggcatcactgctccgccagcaacttctct
gtggtctatactcgctatgggaagtgttacaccttcaacgcggacccgcggagctcgctg
cccagccgggcagggggcatgggcagtggcctggagatcatgctggacatccagcaggag
gagtacctgcccatctggagggagacaaatgagacgtcgtttgaggcaggtattcgggtg
cagatccacagccaggaggagccgccctacatccaccagctggggttcggggtgtcccca
ggcttccagacctttgtgtcctgccaggaacagcggctgacctacctgccccagccctgg
ggcaactgccgcgcagagagtgagctcagggagcctgagcttcagggctactcggcctac
agtgtgtctgcctgccggctgcgctgtgaaaaggaggccgtgcttcagcgctgccactgc
cggatggtgcacatgccagactccctgggtgggggccctgagggcccgtgcttctgcccc
accccctgcaacctgacacgctatgggaaagagatctccatggtcaggatccccaacagg
ggctcagcccggtacctggcgaggaagtacaaccgcaacgagacctacatacgggagaac
ttcctggtcctagatgtcttctttgaggccctgacctctgaagccatggagcagcgagca
gcctatggcctgtcagccctgctgggagacctcgggggacagatgggcctgttcattggg
gccagcatcctcacgttgctggagatcctcgactacatctatgaggtgtcctgggatcga
ctgaagcgggtatggaggcgtcccaagacccccctgcggacctccactgggggcatctcc
actttggggcttcaggagctgaaggaacagagtccctgcccgagccggggccgagtggag
ggtgggggggtcagcagtctgctccccaatcaccaccacccccacggtcccccaggaggt
ctctttgaagattttgcttgctag

DBGET integrated database retrieval system