KEGG   Homo sapiens (human): 5553
Entry
5553              CDS       T01001                                 

Gene name
PRG2, BMPG, MBP, MBP1, proMBP
Definition
(RefSeq) proteoglycan 2, pro eosinophil major basic protein
  KO
K10786  bone marrow proteoglycan
Organism
hsa  Homo sapiens (human)
Pathway
hsa05310  Asthma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    5553 (PRG2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5553 (PRG2)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I63
   5553 (PRG2)
SSDB
Motif
Pfam: Lectin_C DUF4628
Other DBs
NCBI-GeneID: 5553
NCBI-ProteinID: NP_001289855
OMIM: 605601
HGNC: 9362
Ensembl: ENSG00000186652
Vega: OTTHUMG00000167027
Pharos: P13727(Tbio)
UniProt: P13727
Structure
PDB: 
2BRS 1H8U

Position
11q12.1
AA seq 222 aa
MKLPLLLALLFGAVSALHLRSETSTFETPLGAKTLPEDEETPEQEMEETPCRELEEEEEW
GSGSEDASKKDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFSQ
AWFTCRRCYRGNLVSIHNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRW
NFAYWAAHQPWSRGGHCVALCTRGGHWRRAHCLRRLPFICSY
NT seq 669 nt   +upstreamnt  +downstreamnt
atgaaactccccttacttctggctcttctatttggggcagtttctgctcttcatctaagg
tctgagacttccacctttgagacccctttgggtgctaagacgctgcctgaggatgaggag
acaccagagcaggagatggaggagaccccttgcagggagctggaggaagaggaggagtgg
ggctctggaagtgaagatgcctccaagaaagatggggctgttgagtctatctcagtgcca
gatatggtggacaaaaaccttacgtgtcctgaggaagaggacacagtaaaagtggtgggc
atccctgggtgccagacctgccgctacctcctggtgagaagtcttcagacgtttagtcaa
gcttggtttacttgccggaggtgctacaggggcaacctggtttccatccacaacttcaat
attaattatcgaatccagtgttctgtcagcgcgctcaaccagggtcaagtctggattgga
ggcaggatcacaggctcgggtcgctgcagacgctttcagtgggttgacggcagccgctgg
aactttgcatactgggctgctcaccagccctggtcccgcggtggtcactgcgtggccctg
tgtacccgaggaggccactggcgtcgagcccactgcctcagaagacttcctttcatctgt
tcctactga

DBGET integrated database retrieval system