KEGG   Homo sapiens (human): 55561Help
Entry
55561             CDS       T01001                                 

Gene name
CDC42BPG, DMPK2, HSMDPKIN, KAPPA-200, MRCKG, MRCKgamma
Definition
(RefSeq) CDC42 binding protein kinase gamma
  KO
K16307  serine/threonine-protein kinase MRCK [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    55561 (CDC42BPG)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     55561 (CDC42BPG)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   55561 (CDC42BPG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CNH Pkinase_Tyr DMPK_coil C1_1 Kinase-like PH Pkinase_C PBD Haspin_kinase Pkinase_fungal Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 55561
NCBI-ProteinID: NP_059995
OMIM: 613991
HGNC: 29829
Ensembl: ENSG00000171219
Vega: OTTHUMG00000045365
Pharos: Q6DT37(Tbio)
UniProt: Q6DT37
Position
11q13.1
AA seq 1551 aa AA seqDB search
MERRLRALEQLARGEAGGCPGLDGLLDLLLALHHELSSGPLRRERSVAQFLSWASPFVSK
VKELRLQRDDFEILKVIGRGAFGEVTVVRQRDTGQIFAMKMLHKWEMLKRAETACFREER
DVLVKGDSRWVTTLHYAFQDEEYLYLVMDYYAGGDLLTLLSRFEDRLPPELAQFYLAEMV
LAIHSLHQLGYVHRDVKPDNVLLDVNGHIRLADFGSCLRLNTNGMVDSSVAVGTPDYISP
EILQAMEEGKGHYGPQCDWWSLGVCAYELLFGETPFYAESLVETYGKIMNHEDHLQFPPD
VPDVPASAQDLIRQLLCRQEERLGRGGLDDFRNHPFFEGVDWERLASSTAPYIPELRGPM
DTSNFDVDDDTLNHPGTLPPPSHGAFSGHHLPFVGFTYTSGSHSPESSSEAWAALERKLQ
CLEQEKVELSRKHQEALHAPTDHRELEQLRKEVQTLRDRLPEMLRDKASLSQTDGPPAGS
PGQDSDLRQELDRLHRELAEGRAGLQAQEQELCRAQGQQEELLQRLQEAQEREAATASQT
RALSSQLEEARAAQRELEAQVSSLSRQVTQLQGQWEQRLEESSQAKTIHTASETNGMGPP
EGGPQEAQLRKEVAALREQLEQAHSHRPSGKEEALCQLQEENRRLSREQERLEAELAQEQ
ESKQRLEGERRETESNWEAQLADILSWVNDEKVSRGYLQALATKMAEELESLRNVGTQTL
PARPLDHQWKARRLQKMEASARLELQSALEAEIRAKQGLQERLTQVQEAQLQAERRLQEA
EKQSQALQQELAMLREELRARGPVDTKPSNSLIPFLSFRSSEKDSAKDPGISGEATRHGG
EPDLRPEGRRSLRMGAVFPRAPTANTASTEGLPAKPGSHTLRPRSFPSPTKCLRCTSLML
GLGRQGLGCDACGYFCHTTCAPQAPPCPVPPDLLRTALGVHPETGTGTAYEGFLSVPRPS
GVRRGWQRVFAALSDSRLLLFDAPDLRLSPPSGALLQVLDLRDPQFSATPVLASDVIHAQ
SRDLPRIFRVTTSQLAVPPTTCTVLLLAESEGERERWLQVLGELQRLLLDARPRPRPVYT
LKEAYDNGLPLLPHTLCAAILDQDRLALGTEEGLFVIHLRSNDIFQVGECRRVQQLTLSP
SAGLLVVLCGRGPSVRLFALAELENIEVAGAKIPESRGCQVLAAGSILQARTPVLCVAVK
RQVLCYQLGPGPGPWQRRIRELQAPATVQSLGLLGDRLCVGAAGGFALYPLLNEAAPLAL
GAGLVPEELPPSRGGLGEALGAVELSLSEFLLLFTTAGIYVDGAGRKSRGHELLWPAAPM
GWGYAAPYLTVFSENSIDVFDVRRAEWVQTVPLKKVRPLNPEGSLFLYGTEKVRLTYLRN
QLAEKDEFDIPDLTDNSRRQLFRTKSKRRFFFRVSEEQQKQQRREMLKDPFVRSKLISPP
TNFNHLVHVGPANGRPGARDKSPAPEEKGRVARGSGPQRPHSFSEALRRPASMGSEGLGG
DADPMKRKPWTSLSSESVSCPQGSLSPATSLMQVSERPRSLPLSPELESSP
NT seq 4656 nt NT seq  +upstreamnt  +downstreamnt
atggagcggcggctgcgcgcgctggagcagctggcgcggggcgaggccggcggctgcccg
gggctcgacggcctcctagatctgctgctggcgctgcaccacgagctcagcagcggcccc
ctacggcgggagcgcagcgtggcgcagttcctgagctgggccagccccttcgtatcaaag
gtgaaagaactgcgtctgcagagagatgactttgagatcttgaaggtgatcggccgagga
gcctttggggaggtcaccgtggtgaggcagagggacactgggcagatttttgccatgaaa
atgctgcacaagtgggagatgctgaagagggctgagacagcctgtttccgggaggagcgg
gatgtgctcgtgaaaggggacagccgttgggtgaccactctgcactatgccttccaagac
gaggagtacctgtaccttgtgatggactactatgctggtggggacctcctgacgctgctg
agccgcttcgaggaccgtctcccgcccgagctggcccagttctacctggctgagatggtg
ctggccatccactcgctgcaccagctgggttatgtccacagggatgtcaagccagacaac
gtcctgctggatgtgaacgggcacattcgcctggctgacttcggctcctgcctgcgtctc
aacaccaacggcatggtggattcatcagtggcagtagggacgccggactatatctcccct
gagatcctgcaggccatggaggagggcaagggccactacggcccacagtgtgactggtgg
tcgcttggagtctgcgcctatgagctgctctttggggagacgcccttctatgctgagtcc
ttggtggaaacctacggcaagatcatgaaccacgaggaccacctgcagttccccccggac
gtgcctgacgtgccagccagcgcccaagacctgatccgccagctgctgtgtcgccaggaa
gagcggctaggccgtggtgggctggatgacttccggaaccatcctttcttcgaaggcgtg
gactgggagcggctggcgagcagcacggccccctatattcctgagctgcgggggcccatg
gacacctccaactttgatgtggatgacgacaccctcaaccatccagggaccctgccaccg
ccctcccacggggccttctccggccatcacctgccattcgtgggcttcacctacacctca
ggcagtcacagtcctgagagcagctctgaggcttgggctgccctggagcggaagctccag
tgtctggagcaggagaaggtggagctgagcaggaagcaccaagaggccctgcacgccccc
acagaccatcgggagctggagcagctacggaaggaagtgcagactctgcgggacaggctg
ccagagatgctgagggacaaggcctcattgtcccagacggatgggcccccagctggtagc
ccaggtcaggacagtgacctacggcaggagcttgaccgacttcaccgggagctggccgag
ggtcgggcagggctgcaggctcaggagcaggagctctgcagggcccaggggcagcaggag
gagctgcttcagaggctacaggaggcccaggagagagaggcggccacagctagccagacc
cgggccctgagctcccagctggaggaagcccgggctgcccagagggagctggaggcccag
gtgtcctccctgagccggcaggtgacgcagctgcagggacagtgggagcaacgccttgag
gagtcgtcccaggccaagaccatccacacagcctctgagaccaacgggatgggaccccct
gagggtgggcctcaggaggcccaactgaggaaggaggtggccgccctgcgagagcagctg
gagcaggcccacagccacaggccgagtggtaaggaggaggctctgtgccagctgcaggag
gaaaaccggaggctgagccgggagcaggagcggctagaagcagagctggcccaggagcag
gagagcaagcagcggctggagggtgagcggcgggagacggagagcaactgggaggcccag
ctcgccgacatcctcagctgggtgaatgatgagaaggtctcaagaggctacctgcaggcc
ctggccaccaagatggcagaggagctggagtccttgaggaacgtaggcacccagacgctc
cctgcccggccactggaccaccagtggaaggcgcggcgactgcagaagatggaggcctcg
gccaggctggagctgcagtcagcgctggaggccgagatccgcgccaagcagggcctgcag
gagcggctgacacaggtgcaggaggcccagctgcaggctgagcgccgtctgcaggaggcc
gagaagcagagccaggccctgcaacaggagctcgccatgctgcgggaggagctgcgggcc
cgagggccagtggacaccaagccctcaaactccctgattcccttcctgtccttccggagc
tcagagaaggattctgccaaggaccctggcatctcaggagaggccacaaggcatggagga
gagccagatctgaggccggagggccgacgcagcctgcgcatgggggctgtgttccccaga
gcacccactgccaacacagcctctacagaaggtcttcctgctaagcccggctcacacacg
ctgcgcccccggagcttcccatccccgaccaagtgtctccgctgcacctcgctgatgctg
ggcctgggccgccagggcctgggttgtgatgcctgcggctacttttgtcacacaacctgt
gccccacaggccccaccctgccccgtgccccctgacctcctccgcacagccctgggagta
caccccgaaacaggcacaggcactgcctatgagggctttctgtcggtgccgcggccctca
ggtgtccggcggggctggcagcgcgtgtttgctgccctgagtgactcacgcctgctgctg
tttgacgcccctgacctgaggctcagcccgcccagtggggccctcctgcaggtcctagat
ctgagggacccccagttctcggctacccctgtcctggcctctgatgttatccatgcccaa
tccagggacctgccacgcatctttagggtgacaacctcccagctggcagtgccgcccacc
acgtgcactgtgctgctgctggcagagagcgagggggagcgggaacgctggctgcaggtg
ctgggtgagctgcagcggctgctgctggacgcgcggccaagaccccggcccgtgtacaca
ctcaaggaggcttacgacaacgggctgccgctgctgcctcacacgctctgcgctgccatc
ctcgaccaggatcgacttgcgcttggcaccgaggaggggctctttgtcatccatctgcgc
agcaacgacatcttccaggtgggggagtgccggcgcgtgcagcagctgaccttgagcccc
agtgcaggcctgctggtcgtgctgtgtggccgcggccccagcgtgcgtctctttgccctg
gcggagctggagaacatagaggtagcaggtgccaagatccccgagtctcgaggctgccag
gtgctggcagctggaagcatcctgcaggcccgcaccccggtgctctgtgtagccgtcaag
cgccaggtgctctgctaccagctgggcccgggccctgggccctggcagcgccgcatccgt
gagctgcaggcacctgccactgtgcagagcctggggctgctgggcgaccggctatgtgtg
ggcgccgccggtggctttgcactctacccgctgctcaacgaggctgcgccgttggcgctg
ggggccggtttggtgcctgaggagctgccaccatcccgcgggggcctgggtgaggcactg
ggtgccgtggagcttagcctcagcgagttcctgctactcttcaccactgctggcatctac
gtggatggcgcaggccgcaagtctcgtggccacgagctgttgtggccagcagcgcccatg
ggctgggggtatgcggccccctacctgacagtgttcagcgagaactccatcgatgtgttt
gacgtgaggagggcagaatgggtgcagaccgtgccgctcaagaaggtgcggcccctcaat
ccagagggctccctgttcctctacggcaccgagaaggtccgcctgacctacctcaggaac
cagctggcagagaaggacgagttcgacatcccggacctcaccgacaacagccggcgccag
ctgttccgcaccaagagcaagcgccgcttctttttccgcgtgtcggaggagcagcagaag
cagcagcgcagggagatgctgaaggacccttttgtgcgctccaagctcatctcgccgcct
accaacttcaaccacctagtacacgtgggccctgccaacgggcggcccggcgccagggac
aagtccccggctcccgaagagaagggccgagttgcccgcggctccggcccacagcggccc
cacagcttctccgaggcgttgcggcgcccagcctccatgggcagcgaaggcctcggtgga
gacgcagaccccatgaagaggaaaccctggacatccctgtccagcgagtctgtgtcctgc
ccccagggatcgctgagccctgcaacctccctaatgcaggtctcagaacggccccgaagc
ctccccctatcccctgaattggagagctctccttga

DBGET integrated database retrieval system