KEGG   Homo sapiens (human): 5557
Entry
5557              CDS       T01001                                 

Gene name
PRIM1, p49
Definition
(RefSeq) DNA primase subunit 1
  KO
K02684  DNA primase small subunit [EC:2.7.7.102]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    5557 (PRIM1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    5557 (PRIM1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.102  DNA primase AEP
     5557 (PRIM1)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase alpha / primase complex
    5557 (PRIM1)
SSDB
Motif
Pfam: DNA_primase_S
Other DBs
NCBI-GeneID: 5557
NCBI-ProteinID: NP_000937
OMIM: 176635
HGNC: 9369
Ensembl: ENSG00000198056
Vega: OTTHUMG00000170034
Pharos: P49642(Tbio)
UniProt: P49642
Structure
PDB: 

Position
12q13.3
AA seq 420 aa
METFDPTELPELLKLYYRRLFPYSQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSF
NNQSDLEKEMQKMNPYKIDIGAVYSHRPNQHNTVKLGAFQAQEKELVFDIDMTDYDDVRR
CCSSADICPKCWTLMTMAIRIIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSA
VRSGIVEYLSLVKGGQDVKKKVHLSEKIHPFIRKSINIIKKYFEEYALVNQDILENKESW
DKILALVPETIHDELQQSFQKSHNSLQRWEHLKKVASRYQNNIKNDKYGPWLEWEIMLQY
CFPRLDINVSKGINHLLKSPFSVHPKTGRISVPIDLQKVDQFDPFTVPTISFICRELDAI
STNEEEKEENEAESDVKHRTRDYKKTSLAPYVKVFEHFLENLDKSRKGELLKKSDLQKDF
NT seq 1263 nt   +upstreamnt  +downstreamnt
atggagacgtttgaccccaccgagctgcccgagctgcttaaactttattaccggaggctc
tttccctactctcagtactatcgctggctcaactacggtggagtgataaagaattacttt
caacaccgtgaattttcattcacattgaaagatgatatttacattcgctaccaatccttc
aacaaccagagtgatctggaaaaggagatgcagaaaatgaatccatacaagattgatata
ggcgcagtatattctcacagacccaatcaacacaatacagtgaagctgggagctttccag
gctcaggaaaaagaactggtatttgacattgacatgacagactatgacgatgtgaggaga
tgttgtagttctgcagacatatgtcctaagtgctggaccctcatgacaatggccatacgc
atcattgacagagcattgaaggaggactttggatttaagcatcgtctctgggtatattct
ggaaggagaggtgttcattgttgggtctgtgatgaatcagttagaaaactgtcttctgca
gtacgttctgggatagttgagtatttgagccttgtaaagggtggtcaagacgttaaaaag
aaagttcacctaagtgaaaaaattcacccttttatcagaaaatctataaacataataaaa
aaatactttgaagaatatgccttggttaatcaagatattctcgaaaataaagaaagctgg
gataagattttagcccttgttcctgaaacaattcatgatgaacttcaacaaagcttccaa
aagtctcacaattcacttcagcgttgggagcacttgaagaaagtagccagcagatatcag
aataacatcaaaaatgacaaatatggaccctggctggagtgggagattatgctccagtac
tgttttccacggctggatatcaatgtcagcaaaggaatcaatcatctactgaagagccct
tttagtgttcatcctaaaacaggtcgcatatctgtgcctattgatttgcagaaagtggac
cagtttgatccatttactgttccgaccataagcttcatctgccgtgaattggatgccatt
tccactaatgaagaggaaaaagaggagaatgaagctgaatctgatgtcaaacatagaacc
agagattataagaagaccagtctagcaccttatgtgaaagtttttgaacattttcttgaa
aatctggataaatcccgaaaaggagaacttcttaagaagagtgatttacaaaaagatttc
tga

DBGET integrated database retrieval system