KEGG   Homo sapiens (human): 5558
Entry
5558              CDS       T01001                                 

Symbol
PRIM2, PRIM2A, p58
Name
(RefSeq) DNA primase subunit 2
  KO
K02685  DNA primase large subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    5558 (PRIM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    5558 (PRIM2)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase alpha / primase complex
    5558 (PRIM2)
SSDB
Motif
Pfam: DNA_primase_lrg
Other DBs
NCBI-GeneID: 5558
NCBI-ProteinID: NP_000938
OMIM: 176636
HGNC: 9370
Ensembl: ENSG00000146143
Vega: OTTHUMG00000016190
Pharos: P49643(Tbio)
UniProt: P49643
Structure
PDB: 

Position
6p11.2
AA seq 509 aa
MEFSGRKWRKLRLAGDQRNASYPHCLQFYLQPPSENISLIEFENLAIDRVKLLKSVENLG
VSYVKGTEQYQSKLESELRKLKFSYRENLEDEYEPRRRDHISHFILRLAYCQSEELRRWF
IQQEMDLLRFRFSILPKDKIQDFLKDSQLQFEAISDEEKTLREQEIVASSPSLSGLKLGF
ESIYKIPFADALDLFRGRKVYLEDGFAYVPLKDIVAIILNEFRAKLSKALALTARSLPAV
QSDERLQPLLNHLSHSYTGQDYSTQGNVGKISLDQIDLLSTKSFPPCMRQLHKALRENHH
LRHGGRMQYGLFLKGIGLTLEQALQFWKQEFIKGKMDPDKFDKGYSYNIRHSFGKEGKRT
DYTPFSCLKIILSNPPSQGDYHGCPFRHSDPELLKQKLQSYKISPGGISQILDLVKGTHY
QVACQKYFEMIHNVDDCGFSLNHPNQFFCESQRILNGGKDIKKEPIQPETPQPKPSVQKT
KDASSALASLNSSLEMDMEGLEDYFSEDS
NT seq 1530 nt   +upstreamnt  +downstreamnt
atggagttttctggaagaaagtggaggaagctgaggttggcaggtgaccagaggaatgct
tcctaccctcattgccttcagttttacttgcagccaccttctgaaaacatatctttaata
gaatttgaaaacttggctattgatagagttaaattgttaaaatcagttgaaaatcttgga
gtgagctatgtgaaaggaactgaacaataccagagtaagttggagagtgagcttcggaag
ctcaagttttcctacagagaaaacttagaagatgaatatgaaccacgaagaagagatcat
atttctcattttattttgcggcttgcttattgccagtctgaagaacttagacgctggttc
attcaacaagaaatggatctccttcgatttagatttagtattttacccaaggataaaatt
caggatttcttaaaggatagccaattgcagtttgaggctataagtgatgaagagaagact
cttcgagaacaggagattgttgcctcatcaccaagtttaagtggacttaagttggggttc
gagtccatttataagatcccttttgctgatgctctggatttgtttcgaggaaggaaagtc
tatttggaagatggctttgcttacgtaccacttaaggacattgtggcaatcatcctgaat
gaatttagagccaaactgtccaaggctttggcattaacagccaggtccttgcctgctgtg
cagtctgatgaaagacttcagcctctgctcaatcacctcagtcattcctacactggccaa
gattacagtacccagggaaatgttgggaagatttctttagatcagattgatttgctttct
accaaatccttcccaccttgcatgcgtcagttacataaagccttgcgggaaaatcaccat
cttcgtcatggaggccgaatgcagtatggcctatttctgaagggcattggtttaactttg
gaacaggcattgcagttctggaagcaagaatttatcaaaggaaagatggatccagacaag
tttgataaaggttactcttacaacatccgtcacagctttggaaaggaaggcaagaggaca
gactatacacctttcagttgcctgaagattattctgtccaatccaccaagccaaggggat
tatcatgggtgcccattccgtcacagtgatccagagctgctgaagcaaaagttgcagtca
tacaagatctctcctggagggataagccagattttggatttagtaaaggggacacattac
caggtagcctgtcaaaaatactttgagatgatacacaatgtggatgattgtggcttttct
ttgaatcatcctaatcagttcttttgtgagagccaacgtattctaaatggtggtaaagac
ataaagaaggaacctatccaaccagaaactcctcaacccaaaccaagtgtccagaaaacc
aaggatgcatcatctgctctggcctctttaaattcctctctggaaatggatatggaagga
ctagaagattactttagtgaagattcttag

DBGET integrated database retrieval system