KEGG   Homo sapiens (human): 55584Help
Entry
55584             CDS       T01001                                 

Gene name
CHRNA9, HSA243342, NACHRA9
Definition
(RefSeq) cholinergic receptor nicotinic alpha 9 subunit
  KO
K04810  nicotinic acetylcholine receptor alpha-9
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Acetylcholine (DG01133): D00999
Atracurium (DG00771): D00758
Cisatracurium: D00759
Cytisine: D07770
Dimethyltubocurarine: D07272
Doxacurium chloride: D00760
Fazadinium bromide: D07273
Hexamethonium bromide: D02204
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611
Mivacurium chloride: D00763
Nicotine (DG00994): D03365 D05156 D05157
Pancuronium (DG00769): D00492
Pipecuronium bromide: D00764
Rocuronium bromide: D00765
Tubocurarine (DG00767): D02207 D08655
Vecuronium (DG00770): D00767
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    55584 (CHRNA9)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   55584 (CHRNA9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Motif
Other DBs
NCBI-GeneID: 55584
NCBI-ProteinID: NP_060051
OMIM: 605116
HGNC: 14079
Ensembl: ENSG00000174343
Vega: OTTHUMG00000099375
Pharos: Q9UGM1(Tbio)
UniProt: Q9UGM1
Structure
PDB: 

Position
4p14
AA seq 479 aa AA seqDB search
MNWSHSCISFCWIYFAASRLRAAETADGKYAQKLFNDLFEDYSNALRPVEDTDKVLNVTL
QITLSQIKDMDERNQILTAYLWIRQIWHDAYLTWDRDQYDGLDSIRIPSDLVWRPDIVLY
NKADDESSEPVNTNVVLRYDGLITWDAPAITKSSCVVDVTYFPFDNQQCNLTFGSWTYNG
NQVDIFNALDSGDLSDFIEDVEWEVHGMPAVKNVISYGCCSEPYPDVTFTLLLKRRSSFY
IVNLLIPCVLISFLAPLSFYLPAASGEKVSLGVTILLAMTVFQLMVAEIMPASENVPLIG
KYYIATMALITASTALTIMVMNIHFCGAEARPVPHWARVVILKYMSRVLFVYDVGESCLS
PHHSRERDHLTKVYSKLPESNLKAARNKDLSRKKDMNKRLKNDLGCQGKNPQEAESYCAQ
YKVLTRNIEYIAKCLKDHKATNSKGSEWKKVAKVIDRFFMWIFFIMVFVMTILIIARAD
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaactggtcccattcctgcatctccttttgctggatctactttgctgcttccagactg
agagctgcagagacggcagatggaaaatatgctcagaagttgtttaatgacctttttgaa
gattattctaatgctcttcgtccagtggaagatacagataaagtcctgaatgtgaccctg
cagattacgctctctcagattaaggatatggatgaaagaaaccaaattctgactgcttat
ttgtggatccgccaaatctggcacgatgcctatctcacgtgggaccgagatcagtacgat
ggcctagactccatcaggatccccagtgacctcgtgtggaggccagacatcgtcttatat
aacaaggctgatgatgaatcttcagagcctgtgaacaccaatgtggtcctgcggtatgat
gggctgatcacctgggatgcaccggccatcaccaaaagctcctgtgtggtggatgtcacc
tacttcccttttgacaaccagcagtgcaacctgacttttggttcctggacctacaatggc
aatcaggtggacatattcaacgccttggacagcggagatctctctgacttcattgaagat
gtggaatgggaggtccatggcatgcccgctgtgaagaatgtgatctcctatggctgctgc
tctgagccttacccggatgtcacattcaccctccttctgaagaggaggtcctcgttctat
atcgtcaacctcctcatcccatgcgtcctcatatcttttctggctcctctgagtttttat
ctcccagcagcctccggagaaaaggtctccctgggagtgaccatcctgttggccatgact
gtatttcagctaatggtggcagaaatcatgccggcctcagaaaatgtgcccctgataggt
aaatactacatagccacgatggccctgatcacagcctccactgcgttgaccatcatggtg
atgaatatccacttctgtggggccgaggcccggccggtgccacactgggccagggtggtc
atcctgaaatacatgtccagggtcttgtttgtctatgatgtgggtgaaagctgcctcagc
ccgcaccacagtagagagcgggaccacctcacgaaagtttatagcaaactcccagagtct
aacctgaaagcagccaggaacaaagacctttccagaaagaaggacatgaacaaacgctta
aagaacgacctgggctgccagggtaagaaccctcaggaggccgagagttactgtgcacag
tacaaagtgctgacgaggaatattgagtacatcgccaagtgcctcaaagaccacaaggcc
accaattccaaggggagtgaatggaagaaggtggcgaaagtcatagaccgattcttcatg
tggatttttttcattatggtgtttgtgatgactattttgatcatagcaagagcggattag

DBGET integrated database retrieval system