KEGG   Homo sapiens (human): 55586
Entry
55586             CDS       T01001                                 

Gene name
MIOX, ALDRL6
Definition
(RefSeq) myo-inositol oxygenase
  KO
K00469  inositol oxygenase [EC:1.13.99.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00053  Ascorbate and aldarate metabolism
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    55586 (MIOX)
   00562 Inositol phosphate metabolism
    55586 (MIOX)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.99  Miscellaneous
    1.13.99.1  inositol oxygenase
     55586 (MIOX)
SSDB
Motif
Pfam: MIOX HD HDOD
Other DBs
NCBI-GeneID: 55586
NCBI-ProteinID: NP_060054
OMIM: 606774
HGNC: 14522
Ensembl: ENSG00000100253
Vega: OTTHUMG00000150207
Pharos: Q9UGB7(Tbio)
UniProt: Q9UGB7
Structure
PDB: 
2IBN

Position
22q13.33
AA seq 285 aa
MKVTVGPDPSLVYRPDVDPEVAKDKASFRNYTSGPLLDRVFTTYKLMHTHQTVDFVRSKH
AQFGGFSYKKMTVMEAVDLLDGLVDESDPDVDFPNSFHAFQTAEGIRKAHPDKDWFHLVG
LLHDLGKVLALFGEPQWAVVGDTFPVGCRPQASVVFCDSTFQDNPDLQDPRYSTELGMYQ
PHCGLDRVLMSWGHDEYMYQVMKFNKFSLPPEAFYMIRFHSFYPWHTGRDYQQLCSQQDL
AMLPWVREFNKFDLYTKCPDLPDVDKLRPYYQGLIDKYCPGILSW
NT seq 858 nt   +upstreamnt  +downstreamnt
atgaaggtgacggtgggcccagacccttccctggtctaccgacctgatgtggacccagag
gtggccaaagacaaggccagcttccggaactacacgtcaggtcccctcctggaccgtgtc
ttcaccacctacaagctcatgcacacgcaccagacagtggacttcgtcaggagcaagcat
gcccagtttgggggcttctcctacaagaaaatgacagtcatggaggccgtggacctgctg
gatgggctggtggatgagtcggacccggacgtagatttccccaactccttccatgccttc
cagacagcggagggcatccggaaggcccacccagacaaggactggttccacctcgtcggg
ctcctgcacgacctggggaaggtcctggccctgttcggggagccccagtgggctgtcgtc
ggcgacaccttccccgtcggatgccgtccgcaggcctccgtggttttctgcgactccacc
ttccaggacaaccctgacctccaggatcctcgatacagcacagagctcgggatgtatcag
ccccactgtgggctcgacagggtcctcatgtcctggggccatgatgagtacatgtaccag
gtgatgaagtttaacaagttctcactgccccctgaggctttctacatgatccggttccac
tccttctacccctggcacacgggccgcgactaccagcagctgtgcagccagcaggacctg
gccatgctgccctgggtgcgggagttcaacaagttcgacctctacaccaagtgcccggac
ctgccggacgtggacaagctgcggccctactaccaggggctcattgacaagtactgccct
ggcatcctgagctggtga

DBGET integrated database retrieval system