KEGG   Homo sapiens (human): 55588
Entry
55588             CDS       T01001                                 

Gene name
MED29, IXL, MED2
Definition
(RefSeq) mediator complex subunit 29
  KO
K15142  mediator of RNA polymerase II transcription subunit 29
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    55588 (MED29)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Mediator complex
    Head
     55588 (MED29)
SSDB
Motif
Pfam: Med29 PGC7_Stella
Other DBs
NCBI-GeneID: 55588
NCBI-ProteinID: NP_060062
OMIM: 612914
HGNC: 23074
Ensembl: ENSG00000063322
Vega: OTTHUMG00000182969
Pharos: Q9NX70(Tbio)
UniProt: Q9NX70 B4DUA7
Position
19q13.2
AA seq 200 aa
MAASQQQASAASSAAGVSGPSSAGGPGPQQQPQPPAQLVGPAQSGLLQQQQQDFDPVQRY
KMLIPQLKESLQTLMKVAAQNLIQNTNIDNGQKSSDGPIQRFDKCLEEFYALCDQLELCL
RLAHECLSQSCDSAKHSPTLVPTATKPDAVQPDSLPYPQYLAVIKAQISCAKDIHTALLD
CANKVTGKTPAPPAGPGGTL
NT seq 603 nt   +upstreamnt  +downstreamnt
atggctgcatcccagcagcaagcttcagcggcttcctcagctgctggtgtatcgggtcct
agttcggctggcggcccgggtccccagcagcagccgcaaccgccagcacaactggtgggc
cctgcccagagcggcctcctgcagcaacagcaacaggacttcgatcctgtgcagcgttat
aagatgctcatcccgcagctgaaggagagtctacagaccttgatgaaggttgcggcccaa
aacttgattcagaacactaacatcgacaatggacaaaagagcagtgatggacccatacag
cgctttgacaagtgcctggaagagttctatgcactctgtgaccagctggagctgtgcctg
cgcctggcgcatgagtgcctgtcacagagttgtgacagtgccaagcactctccaacgttg
gtgcccacagccaccaagcccgacgcagtgcagcctgacagcctcccctacccacagtac
ctggcggtcatcaaagcccagatttcctgtgccaaggacattcacaccgccctgctggac
tgtgccaacaaggtcacgggcaagacacccgcaccacctgctggccctgggggcactctg
tga

DBGET integrated database retrieval system