KEGG   Homo sapiens (human): 55600
Entry
55600             CDS       T01001                                 

Gene name
ITLN1, HL-1, HL1, INTL, ITLN, LFR, hIntL, omentin
Definition
(RefSeq) intelectin 1
  KO
K17527  intelectin
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:hsa04091]
    55600 (ITLN1)
Lectins [BR:hsa04091]
 Intelectins
  55600 (ITLN1)
SSDB
Motif
Pfam: Fibrinogen_C
Other DBs
NCBI-GeneID: 55600
NCBI-ProteinID: NP_060095
OMIM: 609873
HGNC: 18259
Ensembl: ENSG00000179914
Vega: OTTHUMG00000028604
Pharos: Q8WWA0(Tbio)
UniProt: Q8WWA0
Structure
PDB: 
4WMY 4WMQ

Position
1q23.3
AA seq 313 aa
MNQLSFLLFLIATTRGWSTDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLRT
ENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGNWANY
NTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLG
HNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRV
FNNERAANALCAGMRVTGCNTEHHCIGGGGYFPEASPQQCGDFSGFDWSGYGTHVGYSSS
REITEAAVLLFYR
NT seq 942 nt   +upstreamnt  +downstreamnt
atgaaccaactcagcttcctgctgtttctcatagcgaccaccagaggatggagtacagat
gaggctaatacttacttcaaggaatggacctgttcttcgtctccatctctgcccagaagc
tgcaaggaaatcaaagacgaatgtcctagtgcatttgatggcctgtattttctccgcact
gagaatggtgttatctaccagaccttctgtgacatgacctctgggggtggcggctggacc
ctggtggccagcgtgcacgagaatgacatgcgtgggaagtgcacggtgggcgatcgctgg
tccagtcagcagggcagcaaagcagtctacccagagggggacggcaactgggccaactac
aacacctttggatctgcagaggcggccacgagcgatgactacaagaaccctggctactac
gacatccaggccaaggacctgggcatctggcacgtgcccaataagtcccccatgcagcac
tggagaaacagctccctgctgaggtaccgcacggacactggcttcctccagacactggga
cataatctgtttggcatctaccagaaatatccagtgaaatatggagaaggaaagtgttgg
actgacaacggcccggtgatccctgtggtctatgattttggcgacgcccagaaaacagca
tcttattactcaccctatggccagcgggaattcactgcgggatttgttcagttcagggta
tttaataacgagagagcagccaacgccttgtgtgctggaatgagggtcaccggatgtaac
actgagcaccactgcattggtggaggaggatactttccagaggccagtccccagcagtgt
ggagatttttctggttttgattggagtggatatggaactcatgttggttacagcagcagc
cgtgagataactgaggcagctgtgcttctattctatcgttga

DBGET integrated database retrieval system