KEGG   Homo sapiens (human): 55602Help
Entry
55602             CDS       T01001                                 

Gene name
CDKN2AIP, CARF
Definition
(RefSeq) CDKN2A interacting protein
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: XTBD Ish1
Motif
Other DBs
NCBI-GeneID: 55602
NCBI-ProteinID: NP_060102
OMIM: 615914
HGNC: 24325
Ensembl: ENSG00000168564
Vega: OTTHUMG00000160626
Pharos: Q9NXV6(Tbio)
UniProt: Q9NXV6
Position
4q35.1
AA seq 580 aa AA seqDB search
MAQEVSEYLSQNPRVAAWVEALRCDGETDKHWRHRRDFLLRNAGDLAPAGGAASASTDEA
ADAESGTRNRQLQQLISFSMAWANHVFLGCRYPQKVMDKILSMAEGIKVTDAPTYTTRDE
LVAKVKKRGISSSNEGVEEPSKKRVIEGKNSSAVEQDHAKTSAKTERASAQQENSSTCIG
SAIKSESGNSARSSGISSQNSSTSDGDRSVSSQSSSSVSSQVTTAGSGKASEAEAPDKHG
SASFVSLLKSSVNSHMTQSTDSRQQSGSPKKSALEGSSASASQSSSEIEVPLLGSSGSSE
VELPLLSSKPSSETASSGLTSKTSSEASVSSSVAKNSSSSGTSLLTPKSSSSTNTSLLTS
KSTSQVAASLLASKSSSQTSGSLVSKSTSLASVSQLASKSSSQTSTSQLPSKSTSQSSES
SVKFSCKLTNEDVKQKQPFFNRLYKTVAWKLVAVGGFSPNVNHGELLNAAIEALKATLDV
FFVPLKELADLPQNKSSQESIVCELRCKSVYLGTGCGKSKENAKAVASREALKLFLKKKV
VVKICKRKYRGSEIEDLVLLDEESRPVNLPPALKHPQELL
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggaggtgtcggagtacctgagccagaacccgcgggtggcagcctgggtggag
gcgctgcgctgcgacggcgagactgacaaacactggcgccaccgccgggattttttgctt
cgcaacgccggggacctggcccccgctggcggcgctgcctccgctagcacggatgaagct
gccgacgccgagagcgggacccgaaaccggcagctgcagcagctcatctccttttccatg
gcctgggcgaaccacgtcttcctcgggtgccgataccctcaaaaagttatggataaaata
cttagtatggctgaaggcatcaaagtgacagatgctccaacctatacaacaagagatgaa
ctggttgccaaggtgaagaaaagagggatatcgagtagcaatgaaggggtagaagagcca
tccaaaaaacgagttatagaaggaaaaaacagttctgcagttgagcaagatcacgcaaaa
acctctgccaagacagaacgtgcatcagctcagcaggaaaacagttcaacgtgtataggg
tcggccatcaaatcagagagtgggaactcagctcggagctctggcatctccagtcagaat
agctctacaagtgatggagatcgatctgtttccagccaaagcagcagcagcgtttcctct
caggtaacaacggcaggatctgggaaagcttctgaagcagaagctccagataaacacggt
tctgcatcatttgtttccttgctgaaatccagtgtgaatagtcacatgacccaatccact
gattctagacaacaaagtggatcacctaaaaagagtgctttggaaggctcttcagcctca
gcttctcaaagcagctcagagatcgaggtgcccttgttgggctcctcaggaagctcagag
gtagaattgccactattgtcttccaaacctagttcagagacagcttcaagtgggttaact
tccaaaactagttcagaggcaagtgtttcatcatcagttgctaaaaacagttcctcatca
ggcacatccttactgactcccaagagcagctcttcaacaaatacatcgctgctaacttcc
aagagcacttcccaggtagctgcatcactactagcttccaagagcagctcccagaccagt
ggatctctggtttccaaaagcacttccttagcaagtgtgtcccagttggcttctaagagt
agttctcagactagcacctcacagttgccttctaaaagtacttcacagtcaagtgagagt
tctgtcaaattctcttgcaagttaaccaatgaagatgtgaaacagaagcaaccttttttc
aatagactatataaaacggtggcatggaagttggtagctgttggtggctttagtcccaat
gtgaatcatggagagctcctaaatgcagctattgaggctctgaaagcaacactggatgta
ttttttgtcccactaaaagaattggcagatctgcctcaaaataagagctctcaagaaagt
attgtttgtgaattgaggtgcaagtctgtgtatttgggcactggctgtggaaaaagcaaa
gaaaatgcaaaagcagttgcatcaagagaagcattgaagttatttctcaagaaaaaggtg
gtggtaaaaatatgtaaaaggaaatacagaggcagtgaaatagaagatctagtactcctt
gatgaagaatcgaggcctgtaaacttacctccagcactaaaacatcctcaagaattacta
taa

DBGET integrated database retrieval system