KEGG   Homo sapiens (human): 55604
Entry
55604             CDS       T01001                                 
Symbol
CARMIL1, CARMIL, CARMIL1a, LRRC16, LRRC16A, dJ501N12.1, dJ501N12.5
Name
(RefSeq) capping protein regulator and myosin 1 linker 1
  KO
K20493  leucine-rich repeat-containing protein 16
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    55604 (CARMIL1)
Membrane trafficking [BR:hsa04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    55604 (CARMIL1)
SSDB
Motif
Pfam: CARMIL_C Carm_PH LRR_6 IL34
Other DBs
NCBI-GeneID: 55604
NCBI-ProteinID: NP_060110
OMIM: 609593
HGNC: 21581
Ensembl: ENSG00000079691
Pharos: Q5VZK9(Tbio)
UniProt: Q5VZK9
Structure
Position
6:25279374..25620530
AA seq 1371 aa
MTEESSDVPRELIESIKDVIGRKIKISVKKKVKLEVKGDKVENKVLVLTSCRAFLVTARI
PTKLELTFSYLEIHGVVCSKSAQMIVETEKCSISMKMASPEDVSEVLAHIGTCLRKIFPG
LSPVRIMKKVSMEPSERLASLQALWDSQTVAEQGPCGGFSQMYACVCDWLGFSYREEVQW
DVDTIYLTQDTRELNLQDFSHLDHRDLIPIIAALEYNQWFTKLSSKDLKLSTDVCEQILR
VVSRSNRLEELVLENAGLRTDFAQKLASALAHNPNSGLHTINLAGNPLEDRGVSSLSIQF
AKLPKGLKHLNLSKTSLSPKGVNSLSQSLSANPLTASTLVHLDLSGNVLRGDDLSHMYNF
LAQPNAIVHLDLSNTECSLDMVCGALLRGCLQYLAVLNLSRTVFSHRKGKEVPPSFKQFF
SSSLALMHINLSGTKLSPEPLKALLLGLACNHNLKGVSLDLSNCELRSGGAQVLEGCIAE
IHNITSLDISDNGLESDLSTLIVWLSKNRSIQHLALGKNFNNMKSKNLTPVLDNLVQMIQ
DEESPLQSLSLADSKLKTEVTIIINALGSNTSLTKVDISGNGMGDMGAKMLAKALQINTK
LRTVIWDKNNITAQGFQDIAVAMEKNYTLRFMPIPMYDASQALKTNPEKTEDALQKIENY
LLRNHETRKYLQEQAYRLQQGIVTSTTQQMIDRICVKVQDHLNSLRNCGGDAIQEDLKSA
ERLMRDAKNSKTLLPNLYHVGGASWAGASGLLSSPIQETLESMAGEVTRVVDEQLKALLE
SMVDAAENLCPNVMKKAHIRQDLIHASTEKISIPRTFVKNVLLEQSGIDILNKISEVKLT
VASFLSDRIVDEILDALSHCHHKLADHFSRRGKTLPQQESLEIELAEEKPVKRSIITVEE
LTEIERLEDLDTCMMTPKSKRKSIHSRMLRPVSRAFEMEFDLDKALEEVPIHIEDPPFPS
LRQEKRSSGFISELPSEEGKKLEHFTKLRPKRNKKQQPTQAAVCAANIVSQDGEQNGLMG
RVDEGVDEFFTKKVTKMDSKKWSTRGSESHELNEGGDEKKKRDSRKSSGFLNLIKSRSKS
ERPPTILMTEEPSSPKGAVRSPPVDCPRKDTKAAEHNGNSERIEEIKTPDSFEESQGEEI
GKVERSDSKSSPQAGRRYGVQVMGSGLLAEMKAKQEKRAACAQKKLGNDAVSQDSSSPAL
SGVERSDGGGAVPKLHPGLPENRFGLGTPEKNTKAEPKAEAGSRSRSSSSTPTSPKPLLQ
SPKPSLAARPVIPQKPRTASRPDDIPDSPSSPKVALLPPVLKKVPSDKERDGQSSPQPSP
RTFSQEVSRRSWGQQAQEYQEQKQRSSSKDGHQGSKSNDSGEEAEKEFIFV
NT seq 4116 nt   +upstreamnt  +downstreamnt
atgaccgaggagagctctgacgttcccagggagttgatagaaagcataaaggatgttatt
ggcagaaagataaaaatttcagtgaagaagaaagtaaagttggaagttaagggagacaaa
gttgaaaacaaagtgctggtccttacatcatgccgagccttccttgtaacagcgcgaatc
cccaccaagctcgagttaaccttcagctacttggagattcatggcgtcgtttgcagcaag
tcagctcagatgattgtggaaactgagaagtgcagcatttccatgaagatggcgtcaccc
gaggacgtgagtgaggtgctggctcacataggcacctgcctgaggaagatatttcctggc
ctctctccagtgagaatcatgaaaaaagtctccatggagccatctgagcgcctggctagt
ctccaggcgctgtgggacagccagaccgtggctgagcagggcccctgtggtggattttct
cagatgtatgcctgtgtttgtgactggcttggattttcatacagggaagaagtacaatgg
gatgtggatacaatttatcttacccaagacaccagggaattgaatttacaagattttagt
catcttgaccacagggacctaatacctatcattgctgctctggaatataatcagtggttc
acaaaactgtcctctaaggatctaaaactgtccactgatgtctgtgaacagatcttgagg
gtggtgagtaggtccaatcgactggaagaattggtgttggaaaatgctggacttagaaca
gattttgcacaaaaactggccagtgctctagcacataatcccaactcaggactccacaca
attaaccttgctggcaacccactggaggatagaggtgtgtcctctttaagtattcaattt
gccaaactcccaaagggattaaagcacttaaatttatctaaaacctcattatcacctaaa
ggggtgaacagcctttctcagtcactcagtgccaatccattgaccgcctctacccttgtc
cacctcgacctctcagggaacgtccttcgtggagatgacctctcacacatgtataatttt
ttggcccagccaaatgccattgttcatctggatttatccaatacagaatgttccctggac
atggtctgtggagctcttctccgtggatgccttcaatatttagctgtgctcaacctctcc
agaactgtcttctctcaccggaaaggaaaagaagtacctccatctttcaagcaatttttt
agtagttctctggctttgatgcacatcaacctttcaggcacaaaactgtctcctgagccc
ttaaaagcactgttattgggcctggcttgtaatcataacttgaaaggggtttctctggat
ctcagcaactgtgagctgagatcaggaggtgctcaagtattagaaggttgcattgctgaa
atacacaacatcaccagcttagacatctctgacaatggtttagaatctgacctatctacc
ttaatagtgtggctcagtaaaaacagatcaatacaacacctggcgttaggcaaaaatttt
aataatatgaaatccaaaaatctgacacctgtattggacaacttagtacagatgattcaa
gatgaagaatcacctctgcagtccttgtccctggctgactcgaaactcaagactgaggtc
accatcatcatcaatgccctgggaagcaacacctccctgaccaaagtggacattagcggc
aacggaatgggggacatgggagcgaagatgctggccaaagcactgcagatcaacactaag
ctcaggactgtaatatgggacaagaacaacatcactgcacaaggctttcaggatatagct
gttgctatggaaaagaactacacattaagatttatgccaattcctatgtatgatgcttct
caagccctaaaaacaaaccctgaaaaaacagaagacgctctgcaaaagatagaaaactac
ctgctacgaaatcacgagactagaaaataccttcaagagcaggcctaccgcctgcagcag
ggtattgtcaccagcaccacccagcagatgattgacagaatatgtgtgaaagtacaagat
catctcaactccttacgaaattgtgggggagacgctatccaggaagatttaaaatcagca
gagcggctcatgcgtgatgctaagaactctaaaacgttgttaccaaatttataccatgtt
ggtggtgcatcttgggcgggagccagtggcttactatccagtccaattcaggagaccctg
gaatcaatggctggagaagttacaagagtagtagatgaacaactaaaggcgttgcttgag
tccatggttgatgctgctgagaatctttgtcccaatgtgatgaaaaaagcccacattcga
caagacttgattcatgccagcaccgaaaagatttctattccacgtacctttgttaaaaat
gtcctgttggagcagtctggaattgatatccttaacaaaattagtgaagtaaaattgaca
gtggcctcgttcctgtctgatagaattgtggatgaaatcctggatgcactctcacattgc
catcataaactggctgaccatttcagcagacgtggcaagacccttcctcaacaagaatcc
ttagagatcgagctggctgaggagaagccagttaaacgttccatcatcacagtggaggag
ctaacagagatagagcgtttggaagatctggatacctgtatgatgacccctaaatccaaa
aggaagagtatccatagccgaatgctgcggcctgtttctagggcttttgaaatggagttt
gatctagataaagcgctggaagaggtaccaattcacatcgaagacccgcccttcccatcc
ctcagacaggagaagcggagctcgggatttatctctgagttgccctctgaagaggggaag
aagctggaacactttaccaagttaaggccaaaaaggaataagaagcagcaacccacccaa
gcagcggtctgtgctgccaacatagtctcacaagatggtgaacagaatggtctcatgggg
agagtggatgaaggtgtagatgaattttttaccaagaaggtgaccaaaatggattccaag
aaatggtcaacaagaggctcagagtcccatgagcttaatgaaggaggagatgaaaagaaa
aagcgagattctcggaaaagtagtggctttctcaatttaatcaaatcccggtccaaatcc
gagcgaccaccaacgatcttgatgacagaagaaccctcctcaccaaaaggggcagtcaga
agtccacctgtggactgtcccaggaaggacacaaaggccgccgagcacaatggcaattct
gaacggatagaggagataaaaacacctgactcctttgaagagagtcaaggggaagaaata
gggaaggtggaacggagtgacagcaagagcagcccacaggcagggcggaggtatggggtc
caggtgatgggcagtggtctgctggcagagatgaaagccaagcaagagaagagagctgcg
tgtgcgcagaagaagcttgggaatgatgccgtatcccaggattcttccagcccagctttg
agcggcgtagaacggtcggatggaggtggggcagtgcctaaactgcacccaggtcttcca
gagaaccgctttggtttgggaacaccagaaaagaataccaaagcagaacccaaagcggaa
gcaggctccaggtctcggagctcatccagcacacctacgagcccgaagcccctcctgcag
tcccccaaacccagtctggcagcacggcccgtcatcccgcagaaaccaagaaccgcctca
cggcctgatgacattccagactctccatctagcccgaaagttgcccttcttccacctgtc
ctgaaaaaagttccttcagacaaagagagagatggccagagtagcccccagcccagcccc
aggacattttcacaggaagtttcaaggagaagctggggccagcaggcccaggagtatcaa
gaacaaaagcaacggtcctccagtaaagatggccatcaaggcagcaaatctaatgactcc
ggggaagaagcagaaaaagagtttatttttgtgtaa

DBGET integrated database retrieval system