KEGG   Homo sapiens (human): 55608Help
Entry
55608             CDS       T01001                                 

Gene name
ANKRD10
Definition
(RefSeq) ankyrin repeat domain 10
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_4 Ank_3 Ank Ank_5 DUF1843 HTH_18
Motif
Other DBs
NCBI-GeneID: 55608
NCBI-ProteinID: NP_060134
HGNC: 20265
Ensembl: ENSG00000088448
Vega: OTTHUMG00000017349
Pharos: Q9NXR5(Tdark)
UniProt: Q9NXR5 A0A024RE01
Position
13q34
AA seq 420 aa AA seqDB search
MSAAGAGAGVEAGFSSEELLSLRFPLHRACRDGDLATLCSLLQQTPHAHLASEDSFYGWT
PVHWAAHFGKLECLVQLVRAGATLNVSTTRYAQTPAHIAAFGGHPQCLVWLIQAGANINK
PDCEGETPIHKAARSGSLECISALVANGAHVDLRNASGLTAADIAQTQGFQECAQFLLNL
QNCHLNHFYNNGILNGGHQNVFPNHISVGTNRKRCLEDSEDFGVKKARTEAQSLDSAVPL
TNGDTEDDADKMHVDREFAVVTDMKNSSSVSNTLTNGCVINGHLDFPSTTPLSGMESRNG
QCLTGTNGISSGLAPGQPFPSSQGSLCISGTEEPEKTLRANPELCGSLHLNGSPSSCIAS
RPSWVEDIGDNLYYGHYHGFGDTAESIPELNSVVEHSKSVKVQERYDSAVLGTMHLHHGS
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcggcgggagcgggcgcgggcgtagaggcgggcttctccagcgaggagctgctc
tcgctccgtttcccgctgcaccgcgcctgccgcgacggggacctggccacgctctgctcg
ctgctgcagcagacaccccacgcccacctggcctctgaggactccttctatggctggacg
cccgtgcactgggccgcgcatttcggcaagttggagtgcttagtgcagttggtgagagcg
ggagccacactcaacgtctccaccacacggtacgcgcagacgccagcccacattgcagcc
tttgggggacatcctcagtgcctggtctggctgattcaagcaggagccaacattaacaaa
ccggattgtgagggtgaaactcccattcacaaggcagctcgctctgggagcctagaatgc
atcagtgcccttgtggcgaatggggctcacgtcgacctgagaaatgccagtggcctgaca
gcagcagacattgcacaaacccagggtttccaagagtgtgcccagtttctcttgaacctc
cagaattgtcatctgaaccatttctataacaatggcatcttaaatgggggtcatcagaat
gtatttcctaatcatattagtgtgggaacaaatcgaaagagatgcttggaagactcagaa
gactttggagtaaagaaagctagaactgaagctcaaagcttggattctgccgtgccactc
acgaatggcgacacagaagacgatgctgacaaaatgcacgttgatagggagtttgctgtt
gtaacagatatgaaaaacagtagctccgtatcgaatacattgacaaatggatgtgtcatc
aatggacatttggacttcccctccacgaccccgctcagtgggatggaaagcaggaatggc
cagtgcttgacaggaactaacggaattagcagtggattagccccaggacagccgtttccg
agtagccagggttctctctgcattagtgggactgaggagccagagaagaccctgagagct
aaccctgagttgtgcggttctctgcacctgaacgggagtccaagtagctgcatagccagt
aggccttcctgggtggaagacattggggataacctgtactatggacactaccacgggttt
ggggacactgctgaaagcatcccagaactgaacagtgtggtcgagcattccaagtccgtg
aaggtgcaggagcggtacgacagtgccgtgctgggcaccatgcacctgcaccacggctcc
tag

DBGET integrated database retrieval system