KEGG   Homo sapiens (human): 55611
Entry
55611             CDS       T01001                                 
Symbol
OTUB1, HSPC263, OTB1, OTU1
Name
(RefSeq) OTU deubiquitinase, ubiquitin aldehyde binding 1
  KO
K09602  ubiquitin thioesterase protein OTUB1 [EC:3.4.19.12]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    55611 (OTUB1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    55611 (OTUB1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     55611 (OTUB1)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C65
   55611 (OTUB1)
Ubiquitin system [BR:hsa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   OTU
    55611 (OTUB1)
SSDB
Motif
Pfam: Peptidase_C65 OTU DUF6698 RE_XcyI
Other DBs
NCBI-GeneID: 55611
NCBI-ProteinID: NP_060140
OMIM: 608337
HGNC: 23077
Ensembl: ENSG00000167770
Pharos: Q96FW1(Tbio)
UniProt: Q96FW1 B3KUV5
Structure
Position
11:63986438..63998412
AA seq 271 aa
MAAEEPQQQKQEPLGSDSEGVNCLAYDEAIMAQQDRIQQEIAVQNPLVSERLELSVLYKE
YAEDDNIYQQKIKDLHKKYSYIRKTRPDGNCFYRAFGFSHLEALLDDSKELQRFKAVSAK
SKEDLVSQGFTEFTIEDFHNTFMDLIEQVEKQTSVADLLASFNDQSTSDYLVVYLRLLTS
GYLQRESKFFEHFIEGGRTVKEFCQQEVEPMCKESDHIHIIALAQALSVSIQVEYMDRGE
GGTTNPHIFPEGSEPKVYLLYRPGHYDILYK
NT seq 816 nt   +upstreamnt  +downstreamnt
atggcggcggaggaacctcagcagcagaagcaggagccgctgggcagcgactccgaaggt
gttaactgtctggcctatgatgaagccatcatggctcagcaggaccgaattcagcaagag
attgctgtgcagaaccctctggtgtcagagcggctggagctctcggtcctatacaaggag
tatgctgaagatgacaacatctatcaacagaagatcaaggacctccacaaaaagtactcg
tacatccgcaagaccaggcctgacggcaactgtttctatcgggctttcggattctcccac
ttggaggcactgctggatgacagcaaggagttgcagcggttcaaggctgtgtctgccaag
agcaaggaagacctggtgtcccagggcttcactgaattcacaattgaggatttccacaac
acgttcatggacctgattgagcaggtggagaagcagacctctgtcgccgacctgctggcc
tccttcaatgaccagagcacctccgactaccttgtggtctacctgcggctgctcacctcg
ggctacctgcagcgcgagagcaagttcttcgagcacttcatcgagggtggacggactgtc
aaggagttctgccagcaggaggtggagcccatgtgcaaggagagcgaccacatccacatc
attgcgctggcccaggccctcagcgtgtccatccaggtggagtacatggaccgcggcgag
ggcggcaccaccaatccgcacatcttccctgagggctccgagcccaaggtctaccttctc
taccggcctggacactacgatatcctctacaaatag

DBGET integrated database retrieval system