KEGG   Homo sapiens (human): 55615
Entry
55615             CDS       T01001                                 

Gene name
PRR5, FLJ20185k, PP610, PROTOR-1, PROTOR1
Definition
(RefSeq) proline rich 5
  KO
K20411  proline-rich protein 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    55615 (PRR5)
SSDB
Motif
Pfam: HbrB
Other DBs
NCBI-GeneID: 55615
NCBI-ProteinID: NP_851850
OMIM: 609406
HGNC: 31682
Ensembl: ENSG00000186654
Vega: OTTHUMG00000150460
Pharos: P85299(Tbio)
UniProt: P85299 A8K699
Position
22q13.31
AA seq 388 aa
MRTLRRLKFMSSPSLSDLGKREPAAAADERGTQQRRACANATWNSIHNGVIAVFQRKGLP
DQELFSLNEGVRQLLKTELGSFFTEYLQNQLLTKGMVILRDKIRFYEGQKLLDSLAETWD
FFFSDVLPMLQAIFYPVQGKEPSVRQLALLHFRNAITLSVKLEDALARAHARVPPAIVQM
LLVLQGVHESRGVTEDYLRLETLVQKVVSPYLGTYGLHSSEGPFTHSCILEKRLLRRSRS
GDVLAKNPVVRSKSYNTPLLNPVQEHEAEGAAAGGTSIRRHSVSEMTSCPEPQGFSDPPG
QGPTGTFRSSPAPHSGPCPSRLYPTTQPPEQGLDPTRSSLPRSSPENLVDQILESVDSDS
EGIFIDFGRGRGSGMSDLEGSGGRQSVV
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgaggactctccgcaggttgaagttcatgagttcgcccagcctcagtgacctgggcaag
agagagccggccgccgccgcggacgagcggggcacgcagcagcgccgggcctgcgccaac
gccacctggaacagcatccacaacggggtgatcgccgtcttccagcgcaaggggctgccc
gaccaggagctcttcagcctcaacgagggcgtccggcagctgttgaagacagagctgggg
tccttcttcacggagtacctgcagaaccagctgctgacaaaaggcatggtgatccttcgg
gacaagattcgcttctatgagggacagaagctgctggactcactggcagagacctgggac
ttcttcttcagtgacgtgctgcccatgctgcaggccatcttctacccggtgcagggcaag
gagccatcggtgcgccagctggccctgctgcacttccggaatgccatcaccctcagtgtg
aagctagaggatgcgctggcccgggcccatgcccgtgtgccccctgccatcgtgcagatg
ctgctggtgctgcagggggtacatgagtccaggggcgtgactgaggactacctgcgcctg
gagacgctggtccagaaggtggtgtcgccatacctgggcacctacggcctccactccagc
gaggggcccttcacccattcctgcatcctggaaaagcgcctcctccgccgctcccgctcg
ggggacgtgctggccaagaaccctgtggtgcgctccaagagctacaacacgcctctgctg
aaccccgtgcaggagcacgaggcggagggcgcggcggccggcggtaccagcatccgcagg
cactctgtgtcggagatgacgtcctgccccgagcctcagggcttctccgacccgcccggc
cagggccccaccgggaccttcaggtcctccccggcgccccactcagggccctgccccagc
agactgtaccccacgacccagccccctgagcagggcttggatcccacccgcagctccctg
ccccgctccagcccggagaacctggtggaccagatcctggagtccgtggactcggattct
gaagggattttcattgactttggccggggccggggctctggcatgtccgacttggagggc
tctgggggccggcagagtgtcgtgtga

DBGET integrated database retrieval system