KEGG   Homo sapiens (human): 55620
Entry
55620             CDS       T01001                                 

Gene name
STAP2, BKS
Definition
(RefSeq) signal transducing adaptor family member 2
  KO
K24026   
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: SH2 SH2_2
Other DBs
NCBI-GeneID: 55620
NCBI-ProteinID: NP_001013863
OMIM: 607881
HGNC: 30430
Ensembl: ENSG00000178078
Vega: OTTHUMG00000181884
Pharos: Q9UGK3(Tbio)
UniProt: Q9UGK3
Structure
PDB: 
2EL8

Position
19p13.3
AA seq 403 aa
MASALRPPRVPKPKGVLPSHYYESFLEKKGPCDRDYKKFWAGLQGLTIYFYNSNRDFQHV
EKLNLGAFEKLTDEIPWGSSRDPGTHFSLILRDQEIKFKVETLECREMWKGFILTVVELR
VPTDLTLLPGHLYMMSEVLAKEEARRALETPSCFLKVSRLEAQLLLERYPECGNLLLRPS
GDGADGVSVTTRQMHNGTHVVRHYKVKREGPKYVIDVEQPFSCTSLDAVVNYFVSHTKKA
LVPFLLDEDYEKVLGYVEADKENGENVWVAPSAPGPGPAPCTGGPKPLSPASSQDKLPPL
PPLPNQEENYVTPIGDGPAVDYENQDVASSSWPVILKPKKLPKPPAKLPKPPVGPKPEPK
VFNGGLGRKLPVSSAQPLFPTAGLADMTAELQKKLEKRRALEH
NT seq 1212 nt   +upstreamnt  +downstreamnt
atggcctctgccctgaggccaccccgtgtccccaagcctaagggtgtcctgccttcacac
tactatgagagctttctagagaagaaggggccctgtgaccgggattacaagaagttctgg
gcaggcctgcagggtctcaccatttatttctacaatagcaatcgggacttccagcacgtg
gagaagctcaacttgggagcatttgagaaactcacagatgagattccctggggaagctca
cgtgaccctggcacccacttcagcctgattctccgggatcaggagatcaagttcaaggta
gagaccttggagtgtcgggaaatgtggaaaggcttcatcttaacggtggtggagctccgt
gtcccgaccgacttgaccctgcttcctgggcacctatacatgatgtctgaagtcttggcc
aaagaggaggcgcgccgtgcactggagacaccctcgtgcttcctgaaggtgagccggctg
gaggcacaactgctcctggagcgctaccccgagtgcgggaacctgctgctgcggcccagc
ggggacggcgccgacggcgtgtcggtcaccacgcggcagatgcacaacgggacgcacgtg
gtccggcattacaaggtgaagcgggagggccccaagtacgtgatcgatgtggaacagccg
ttctcttgcacctccctggacgccgtggtcaactatttcgtgtcgcataccaaaaaggcg
ctggtgccattcctgttagacgaggactacgagaaggtgctaggctacgtggaagccgat
aaggagaatggcgagaatgtgtgggtggcgccctccgctccgggcccaggtcctgcaccc
tgcacaggtggccccaagccgctgtcacctgcgtctagccaggacaagctgcccccactg
cccccactaccgaaccaggaagagaactacgtgacccccattggagatggcccagctgtt
gactatgagaaccaagatgtggcttcctctagttggccagtcatcctgaagccaaagaag
ttgccaaagcctcctgccaagcttccaaagccacccgttggacccaagccagagcccaaa
gtctttaatggtggcttgggcaggaagctgccagtcagttcagcccagcctctcttcccc
acagccgggctggcagacatgacggcagagctacagaagaagctggagaagaggcgggca
ctggagcactga

DBGET integrated database retrieval system