KEGG   Homo sapiens (human): 55635Help
Entry
55635             CDS       T01001                                 

Gene name
DEPDC1, DEP.8, DEPDC1-V2, DEPDC1A, SDP35
Definition
(RefSeq) DEP domain containing 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: DEP RhoGAP
Motif
Other DBs
NCBI-GeneID: 55635
NCBI-ProteinID: NP_001107592
OMIM: 612002
HGNC: 22949
Ensembl: ENSG00000024526
Vega: OTTHUMG00000009212
Pharos: Q5TB30(Tbio)
UniProt: Q5TB30
Structure
PDB: 

Position
1p31.3
AA seq 811 aa AA seqDB search
MESQGVPPGPYRATKLWNEVTTSFRAGMPLRKHRQHFKKYGNCFTAGEAVDWLYDLLRNN
SNFGPEVTRQQTIQLLRKFLKNHVIEDIKGRWGSENVDDNNQLFRFPATSPLKTLPRRYP
ELRKNNIENFSKDKDSIFKLRNLSRRTPKRHGLHLSQENGEKIKHEIINEDQENAIDNRE
LSQEDVEEVWRYVILIYLQTILGVPSLEEVINPKQVIPQYIMYNMANTSKRGVVILQNKS
DDLPHWVLSAMKCLANWPRSNDMNNPTYVGFERDVFRTIADYFLDLPEPLLTFEYYELFV
NILVVCGYITVSDRSSGIHKIQDDPQSSKFLHLNNLNSFKSTECLLLSLLHREKNKEESD
STERLQISNPGFQERCAKKMQLVNLRNRRVSANDIMGGSCHNLIGLSNMHDLSSNSKPRC
CSLEGIVDVPGNSSKEASSVFHQSFPNIEGQNNKLFLESKPKQEFLLNLHSEENIQKPFS
AGFKRTSTLTVQDQEELCNGKCKSKQLCRSQSLLLRSSTRRNSYINTPVAEIIMKPNVGQ
GSTSVQTAMESELGESSATINKRLCKSTIELSENSLLPASSMLTGTQSLLQPHLERVAID
ALQLCCLLLPPPNRRKLQLLMRMISRMSQNVDMPKLHDAMGTRSLMIHTFSRCVLCCAEE
VDLDELLAGRLVSFLMDHHQEILQVPSYLQTAVEKHLDYLKKGHIENPGDGLFAPLPTYS
YCKQISAQEFDEQKVSTSQAAIAELLENIIKNRSLPLKEKRKKLKQFQKEYPLIYQKRFP
TTESEAALFGDKPTIKQPMLILRKPKFRSLR
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atggagagtcagggtgtgcctcccgggccttatcgggccaccaagctgtggaatgaagtt
accacatcttttcgagcaggaatgcctctaagaaaacacagacaacactttaaaaaatat
ggcaattgtttcacagcaggagaagcagtggattggctttatgacctattaagaaataat
agcaattttggtcctgaagttacaaggcaacagactatccaactgttgaggaaatttctt
aagaatcatgtaattgaagatatcaaagggaggtggggatcagaaaatgttgatgataac
aaccagctcttcagatttcctgcaacttcgccacttaaaactctaccacgaaggtatcca
gaattgagaaaaaacaacatagagaacttttccaaagataaagatagcatttttaaatta
cgaaacttatctcgtagaactcctaaaaggcatggattacatttatctcaggaaaatggc
gagaaaataaagcatgaaataatcaatgaagatcaagaaaatgcaattgataatagagaa
ctaagccaggaagatgttgaagaagtttggagatatgttattctgatctacctgcaaacc
attttaggtgtgccatccctagaagaagtcataaatccaaaacaagtaattccccaatat
ataatgtacaacatggccaatacaagtaaacgtggagtagttatactacaaaacaaatca
gatgacctccctcactgggtattatctgccatgaagtgcctagcaaattggccaagaagc
aatgatatgaataatccaacttatgttggatttgaacgagatgtattcagaacaatcgca
gattattttctagatctccctgaacctctacttacttttgaatattacgaattatttgta
aacattttggttgtttgtggctacatcacagtttcagatagatccagtgggatacataaa
attcaagatgatccacagtcttcaaaattccttcacttaaacaatttgaattccttcaaa
tcaactgagtgccttcttctcagtctgcttcatagagaaaaaaacaaagaagaatcagat
tctactgagagactacagataagcaatccaggatttcaagaaagatgtgctaagaaaatg
cagctagttaatttaagaaacagaagagtgagtgctaatgacataatgggaggaagttgt
cataatttaatagggttaagtaatatgcatgatctatcctctaacagcaaaccaaggtgc
tgttctttggaaggaattgtagatgtgccagggaattcaagtaaagaggcatccagtgtc
tttcatcaatcttttccgaacatagaaggacaaaataataaactgtttttagagtctaag
cccaaacaggaattcctgttgaatcttcattcagaggaaaatattcaaaagccattcagt
gctggttttaagagaacctctactttgactgttcaagaccaagaggagttgtgtaatggg
aaatgcaagtcaaaacagctttgtaggtctcagagtttgcttttaagaagtagtacaaga
aggaatagttatatcaatacaccagtggctgaaattatcatgaaaccaaatgttggacaa
ggcagcacaagtgtgcaaacagctatggaaagtgaactcggagagtctagtgccacaatc
aataaaagactctgcaaaagtacaatagaactttcagaaaattctttacttccagcttct
tctatgttgactggcacacaaagcttgctgcaacctcatttagagagggttgccatcgat
gctctacagttatgttgtttgttacttcccccaccaaatcgtagaaagcttcaactttta
atgcgtatgatttcccgaatgagtcaaaatgttgatatgcccaaacttcatgatgcaatg
ggtacgaggtcactgatgatacataccttttctcgatgtgtgttatgctgtgctgaagaa
gtggatcttgatgagcttcttgctggaagattagtttctttcttaatggatcatcatcag
gaaattcttcaagtaccctcttacttacagactgcagtggaaaaacatcttgactactta
aaaaagggacatattgaaaatcctggagatggactatttgctcctttgccaacttactca
tactgtaagcagattagtgctcaggagtttgatgagcaaaaagtttctacctctcaagct
gcaattgcagaacttttagaaaatattattaaaaacaggagtttacctctaaaggagaaa
agaaaaaaactaaaacagtttcagaaggaatatcctttgatatatcagaaaagatttcca
accacggagagtgaagcagcactttttggtgacaaacctacaatcaagcaaccaatgctg
attttaagaaaaccaaagttccgtagtctaagataa

DBGET integrated database retrieval system