KEGG   Homo sapiens (human): 55647Help
Entry
55647             CDS       T01001                                 

Gene name
RAB20
Definition
(RefSeq) RAB20, member RAS oncogene family
  KO
K07911  Ras-related protein Rab-20
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    55647 (RAB20)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab20/21/24 [OT]
    55647 (RAB20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf MMR_HSR1 GTP_EFTU TniB PduV-EutP SRPRB ATPase_2 AAA_16
Motif
Other DBs
NCBI-GeneID: 55647
NCBI-ProteinID: NP_060287
HGNC: 18260
Ensembl: ENSG00000139832
Vega: OTTHUMG00000017343
Pharos: Q9NX57(Tbio)
UniProt: Q9NX57
Position
13q34
AA seq 234 aa AA seqDB search
MRKPDSKIVLLGDMNVGKTSLLQRYMERRFPDTVSTVGGAFYLKQWRSYNISIWDTAGRE
QFHGLGSMYCRGAAAIILTYDVNHRQSLVELEDRFLGLTDTASKDCLFAIVGNKVDLTEE
GALAGQEKEECSPNMDAGDRVSPRAPKQVQLEDAVALYKKILKYKMLDEQDVPAAEQMCF
ETSAKTGYNVDLLFETLFDLVVPMILQQRAERPSHTVDISSHKPPKRTRSGCCA
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagcccgacagcaagatcgtgctcctgggggacatgaacgtggggaagacgtcg
ctgctgcagcggtatatggagcggcgcttcccggacacggtcagcacggtgggcggcgcc
ttctacctgaagcagtggcgctcctacaacatctccatctgggacaccgcagggcgggag
cagttccacggcctgggctccatgtactgccggggggcggccgccatcatcctcacctat
gatgtgaatcaccggcagagcctggtggagctggaggaccggttcctgggcctgacagac
acagccagcaaagactgcctctttgccatcgtggggaacaaagtggacctcactgaggag
ggggccttggcgggccaggagaaggaagagtgcagtcccaatatggacgctggggaccgt
gtctccccaagggcacctaagcaggtgcagctggaggatgcggtggccctttataaaaag
atcctcaagtacaagatgctggatgagcaggatgtgccggccgctgagcaaatgtgcttt
gagaccagcgccaagaccggctacaatgtggacctcctgtttgagaccctctttgacctg
gtggtgccaatgatcttacagcagagagctgagaggccgtcacacacagtggatatatcc
agtcataagccacccaagaggaccagatctgggtgttgtgcctga

DBGET integrated database retrieval system