KEGG   Homo sapiens (human): 55651Help
Entry
55651             CDS       T01001                                 

Gene name
NHP2, DKCB2, NHP2P, NOLA2
Definition
(RefSeq) NHP2 ribonucleoprotein
  KO
K11129  H/ACA ribonucleoprotein complex subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03008  Ribosome biogenesis in eukaryotes
Module
hsa_M00425  H/ACA ribonucleoprotein complex
Disease
H00507  Dyskeratosis congenita (DC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    55651 (NHP2)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Sno RNPs
   Box H/ACA snoRNPs
    55651 (NHP2)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Telomerase complex (animals)
    Dyskerin complex
     55651 (NHP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L7Ae Phage_RpbA Ribosomal_L31e
Motif
Other DBs
NCBI-GeneID: 55651
NCBI-ProteinID: NP_060308
OMIM: 606470
HGNC: 14377
Ensembl: ENSG00000145912
Vega: OTTHUMG00000130886
Pharos: Q9NX24(Tbio)
UniProt: Q9NX24
Position
5q35.3
AA seq 153 aa AA seqDB search
MTKIKADPDGPEAQAEACSGERTYQELLVNQNPIAQPLASRRLTRKLYKCIKKAVKQKQI
RRGVKEVQKFVNKGEKGIMVLAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGS
KRPTCVIMVKPHEEYQEAYDECLEEVQSLPLPL
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaataaaggcagatcccgacgggcccgaggctcaggcggaggcgtgttccggg
gagcgcacctaccaggagctgctggtcaaccagaaccccatcgcgcagcccctggcttct
cgccgcctcacgcggaagctctacaaatgcatcaagaaagcggtgaagcagaagcagatt
cggcgcggggtgaaagaggttcagaaatttgtcaacaaaggagaaaaagggatcatggtt
ttggcaggagacacactgcccattgaggtatactgccatctcccagtcatgtgtgaggac
cgaaatttgccctatgtctatatcccctctaagacggacctgggtgcagccgcaggctcc
aagcgccccacctgtgtgataatggtcaagccccatgaggagtaccaggaggcttacgat
gagtgcctggaggaggtgcagtccctgcccctacccctatga

DBGET integrated database retrieval system