KEGG   Homo sapiens (human): 55655Help
Entry
55655             CDS       T01001                                 

Gene name
NLRP2, CLR19.9, NALP2, NBS1, PAN1, PYPAF2
Definition
(RefSeq) NLR family pyrin domain containing 2
  KO
K19409  NACHT, LRR and PYD domains-containing protein 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hsa04054]
    55655 (NLRP2)
Pattern recognition receptors [BR:hsa04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   55655 (NLRP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NACHT PYRIN LRR_6 AAA_16 AAA_22 AAA_25 AAA AAA_24 RNA_helicase NB-ARC RuvB_N
Motif
Other DBs
NCBI-GeneID: 55655
NCBI-ProteinID: NP_001167552
OMIM: 609364
HGNC: 22948
Ensembl: ENSG00000022556
Vega: OTTHUMG00000167763
Pharos: Q9NX02(Tbio)
UniProt: Q9NX02
Position
19q13.42
AA seq 1062 aa AA seqDB search
MVSSAQMGFNLQALLEQLSQDELSKFKYLITTFSLAHELQKIPHKEVDKADGKQLVEILT
THCDSYWVEMASLQVFEKMHRMDLSERAKDEVREAALKSFNKRKPLSLGITRKERPPLDV
DEMLERFKTEAQAFTETKGNVICLGKEVFKGKKPDKDNRCRYILKTKFREMWKSWPGDSK
EVQVMAERYKMLIPFSNPRVLPGPFSYTVVLYGPAGLGKTTLAQKLMLDWAEDNLIHKFK
YAFYLSCRELSRLGPCSFAELVFRDWPELQDDIPHILAQARKILFVIDGFDELGAAPGAL
IEDICGDWEKKKPVPVLLGSLLNRVMLPKAALLVTTRPRALRDLRILAEEPIYIRVEGFL
EEDRRAYFLRHFGDEDQAMRAFELMRSNAALFQLGSAPAVCWIVCTTLKLQMEKGEDPVP
TCLTRTGLFLRFLCSRFPQGAQLRGALRTLSLLAAQGLWAQTSVLHREDLERLGVQESDL
RLFLDGDILRQDRVSKGCYSFIHLSFQQFLTALFYTLEKEEEEDRDGHTWDIGDVQKLLS
GVERLRNPDLIQAGYYSFGLANEKRAKELEATFGCRMSPDIKQELLRCDISCKGGHSTVT
DLQELLGCLYESQEEELVKEVMAQFKEISLHLNAVDVVPSSFCVKHCRNLQKMSLQVIKE
NLPENVTASESDAEVERSQDDQHMLPFWTDLCSIFGSNKDLMGLAINDSFLSASLVRILC
EQIASDTCHLQRVVFKNISPADAHRNLCLALRGHKTVTYLTLQGNDQDDMFPALCEVLRH
PECNLRYLGLVSCSATTQQWADLSLALEVNQSLTCVNLSDNELLDEGAKLLYTTLRHPKC
FLQRLSLENCHLTEANCKDLAAVLVVSRELTHLCLAKNPIGNTGVKFLCEGLRYPECKLQ
TLVLWNCDITSDGCCDLTKLLQEKSSLLCLDLGLNHIGVKGMKFLCEALRKPLCNLRCLW
LWGCSIPPFSCEDLCSALSCNQSLVTLDLGQNPLGSSGVKMLFETLTCSSGTLRTLRLKI
DDFNDELNKLLEEIEEKNPQLIIDTEKHHPWAERPSSHDFMI
NT seq 3189 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcttcggcgcagatgggcttcaacctgcaggctctcctggagcagctcagccag
gatgagttgagcaagttcaagtatctgatcacgaccttctccctggcacacgagctccag
aagatcccccacaaggaggtagacaaggctgatgggaagcaactggtagaaatcctcacc
acccattgtgacagctactgggtggagatggcgagcctccaggtctttgaaaagatgcac
cgaatggatctgtctgagagagcaaaggatgaagtcagagaagcagctttgaaatccttt
aataaaaggaagcctctatcattagggataacacggaaagaacgaccacctctagacgtg
gacgaaatgctggagcgcttcaaaacagaagcacaagcgtttacagaaacgaaaggaaat
gtcatctgcctgggtaaagaagtctttaaaggaaaaaagccagacaaagacaataggtgc
aggtatatattgaagacgaagttccgggagatgtggaagagctggcctggagatagcaaa
gaggtccaggttatggctgagagatacaagatgctgatcccattcagcaaccccagggtg
cttcccgggcccttctcatacacggtggtgctgtatggtcctgcaggccttgggaaaacc
acgctggcccagaaactaatgctagactgggcagaggacaacctcatccacaaattcaaa
tatgcgttctacctcagctgcagggagctcagccgcctgggcccgtgcagttttgcagag
ctggtcttcagggactggcctgaattgcaggatgacattccacacatcctagcccaagca
cggaaaatcttgttcgtgattgacggctttgatgagctgggagccgcacctggggcgctg
atcgaggacatctgcggggactgggagaagaagaagccggtgcccgtcctcctggggagt
ttgctgaacagggtgatgttacccaaggccgccctgctggtcaccacgcggcccagggcc
ctgagggacctccggatcctggcggaggagccgatctacataagggtggagggcttcctg
gaggaggacaggagggcctatttcctgagacactttggagacgaggaccaagccatgcgt
gcctttgagctaatgaggagcaacgcggccctgttccagctgggctcggcccccgcggtg
tgctggatcgtgtgcacgactctgaagctgcagatggagaagggggaggacccggtcccc
acctgcctcacccgcacggggctgttcctgcgtttcctctgcagccggttcccgcagggc
gcacagctgcggggcgcgctgcggacgctgagcctcctggccgcgcagggcctgtgggcg
cagacgtccgtgcttcaccgagaggatctggaaaggctcggggtgcaggagtccgacctc
cgtctgttcctggacggagacatcctccgccaggacagagtctccaaaggctgctactcc
ttcatccacctcagcttccagcagtttctcactgccctgttctacaccctggagaaggag
gaggaagaggatagggacggccacacctgggacattggggacgtacagaagctgctttcc
ggagtagaaagactcaggaaccccgacctgatccaagcaggctactactcctttggcctc
gctaacgagaagagagccaaggagttggaggccacttttggctgccggatgtcaccggac
atcaaacaggaattgctgcgatgcgacataagttgtaagggtggacattcaacggtgaca
gacctgcaggagctcctcggctgtctgtacgagtctcaggaggaggagctggtgaaggag
gtgatggctcagttcaaagaaatatccctgcacttaaatgcagtagacgttgtgccatct
tcattctgcgtcaagcactgtcgaaacctgcagaaaatgtcactgcaggtaataaaggag
aatctcccggagaatgtcactgcgtctgaatcagacgccgaggttgagagatcccaggat
gatcagcacatgcttcctttctggacggacctttgttccatatttggatcaaataaggat
ctgatgggtctagcaatcaatgatagctttctcagtgcctccctagtaaggatcctgtgt
gaacaaatagcctctgacacctgtcatctccagagagtggtgttcaaaaacatttcccca
gctgatgctcatcggaacctctgcctagctcttcgaggtcacaagactgtaacgtatctg
acccttcaaggcaatgaccaggatgatatgtttcccgcattgtgtgaggtcttgagacat
ccagaatgtaacctgcgatatctcgggttggtgtcttgttccgctaccactcagcagtgg
gctgatctctccttggcccttgaagtcaaccagtccctgacgtgcgtaaacctctccgac
aatgagcttctggatgagggtgctaagttgctgtacacaactttgagacaccccaagtgc
tttctgcagaggttgtcgttggaaaactgtcaccttacagaagccaattgcaaggacctt
gctgctgtgttggttgtcagccgggagctgacacacctgtgcttggccaagaaccccatt
gggaatacaggggtgaagtttctgtgtgagggcttgaggtaccccgagtgtaaactgcag
accttggtgctttggaactgcgacataactagcgatggctgctgcgatctcacaaagctt
ctccaagaaaaatcaagcctgttgtgtttggatctggggctgaatcacataggagttaag
ggaatgaagttcctgtgtgaggctttgaggaaaccactgtgcaacttgagatgtctgtgg
ttgtggggatgttccatccctccgttcagttgtgaagacctctgctctgccctcagctgc
aaccagagcctcgtcactctggacctgggtcagaatcccttggggtctagtggagtgaag
atgctgtttgaaaccttgacatgttccagtggcaccctccggacactcaggttgaaaatc
gatgactttaatgatgaactcaataagctgctggaagaaatagaagaaaaaaacccacaa
ctgattattgatactgagaaacatcatccctgggcagaaaggccttcttctcatgacttc
atgatctga

DBGET integrated database retrieval system