KEGG   Homo sapiens (human): 55656
Entry
55656             CDS       T01001                                 

Gene name
INTS8, C8orf52, INT8, NEDCHS
Definition
(RefSeq) integrator complex subunit 8
  KO
K13145  integrator complex subunit 8
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    55656 (INTS8)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   Integrator complex
    55656 (INTS8)
SSDB
Motif
Pfam: TPR_2 TPR_11
Other DBs
NCBI-GeneID: 55656
NCBI-ProteinID: NP_060334
OMIM: 611351
HGNC: 26048
Ensembl: ENSG00000164941
Vega: OTTHUMG00000164695
Pharos: Q75QN2(Tdark)
UniProt: Q75QN2
Position
8q22.1
AA seq 995 aa
MSAEAADREAATSSRPCTPPQTCWFEFLLEESLLEKHLRKPCPDPAPVQLIVQFLEQASK
PSVNEQNQVQPPPDNKRNRILKLLALKVAAHLKWDLDILEKSLSVPVLNMLLNELLCISK
VPPGTKHVDMDLATLPPTTAMAVLLYNRWAIRTIVQSSFPVKQAKPGPPQLSVMNQMQQE
KELTENILKVLKEQAADSILVLEAALKLNKDLYVHTMRTLDLLAMEPGMVNGETESSTAG
LKVKTEEMQCQVCYDLGAAYFQQGSTNSAVYENAREKFFRTKELIAEIGSLSLHCTIDEK
RLAGYCQACDVLVPSSDSTSQQLTPYSQVHICLRSGNYQEVIQIFIEDNLTLSLPVQFRQ
SVLRELFKKAQQGNEALDEICFKVCACNTVRDILEGRTISVQFNQLFLRPNKEKIDFLLE
VCSRSVNLEKASESLKGNMAAFLKNVCLGLEDLQYVFMISSHELFITLLKDEERKLLVDQ
MRKRSPRVNLCIKPVTSFYDIPASASVNIGQLEHQLILSVDPWRIRQILIELHGMTSERQ
FWTVSNKWEVPSVYSGVILGIKDNLTRDLVYILMAKGLHCSTVKDFSHAKQLFAACLELV
TEFSPKLRQVMLNEMLLLDIHTHEAGTGQAGERPPSDLISRVRGYLEMRLPDIPLRQVIA
EECVAFMLNWRENEYLTLQVPAFLLQSNPYVKLGQLLAATCKELPGPKESRRTAKDLWEV
VVQICSVSSQHKRGNDGRVSLIKQRESTLGIMYRSELLSFIKKLREPLVLTIILSLFVKL
HNVREDIVNDITAEHISIWPSSIPNLQSVDFEAVAITVKELVRYTLSINPNNHSWLIIQA
DIYFATNQYSAALHYYLQAGAVCSDFFNKAVPPDVYTDQVIKRMIKCCSLLNCHTQVAIL
CQFLREIDYKTAFKSLQEQNSHDAMDSYYDYIWDVTILEYLTYLHHKRGETDKRQIAIKA
IGQTELNASNPEEVLQLAAQRRKKKFLQAMAKLYF
NT seq 2988 nt   +upstreamnt  +downstreamnt
atgagcgcggaggcggcggaccgggaggcggccacctccagccggccctgcaccccgccg
cagacctgctggtttgagtttctgctggaggagtcactgttggagaaacatctgcgcaag
ccctgcccggatcctgcaccagttcaacttatagttcagtttttggaacaggcttccaaa
ccttcagttaatgaacaaaaccaagttcaacctccgcctgataacaagagaaatcgtatt
ttaaaactacttgctcttaaagttgctgcacatttgaagtgggacttagacatattagag
aaaagtttgtctgttccagtattgaatatgctactaaatgaactactctgcatcagtaaa
gttcctcctgggacaaagcatgtagacatggatctggccactttacctccgaccactgcc
atggctgtacttctctataatagatgggcaattaggacaattgttcaaagtagttttcca
gtcaaacaggcaaaacccggaccccctcagttaagtgttatgaatcaaatgcaacaggaa
aaagagctaacagaaaacattttgaaagtgctcaaagaacaagctgctgattctattttg
gtactagaagcagccctaaaattaaacaaggatctttatgtccatacgatgagaactcta
gatttattggccatggaaccaggcatggtaaatggagaaactgagagttctactgctgga
ttgaaagtcaaaaccgaagaaatgcagtgccaggtgtgctatgatttgggcgcagcatac
ttccagcaaggctccacaaattcagctgtctatgaaaatgccagggaaaaattttttaga
accaaagaactaattgcagagataggttcattatctcttcattgtaccatagatgagaag
cggttagctggctattgtcaagcatgtgatgttcttgtaccttcttctgatagtacatct
caacagttgactccatatagtcaagtccatatttgtttgagatctggcaactatcaggag
gtaatacagattttcattgaagacaacttaaccttgagtttacctgtccagttccgacag
tcagtcctaagagaactctttaagaaagctcaacagggaaatgaagctctagatgaaatc
tgttttaaagtttgtgcctgtaatacagtccgtgatatactggaaggcagaacaattagt
gttcaatttaaccagctatttcttagaccaaataaagagaaaatagactttcttcttgag
gtatgttcaagatcagtaaatttagaaaaagcttcagagtctttgaaaggaaacatggct
gcttttctaaagaatgtgtgtctggggttggaagatctgcagtatgttttcatgatttct
tcacatgagcttttcattacattgttgaaagatgaagaacgaaagctacttgttgatcag
atgaggaagagatcccctagagtaaatctgtgcattaaacctgtaacttcattttatgat
atcccagcttcagcaagtgtcaacattggtcagttagagcatcaacttatattgtcagtg
gatccttggaggattagacaaattttaattgaattacatggtatgacttcagagcgccag
ttctggacagtgtctaataagtgggaagtaccttctgtctatagtggtgttatcctggga
attaaagacaatttaacaagagatttggtttatattcttatggccaaaggtttgcactgc
agtactgttaaggacttttcccatgctaaacagctctttgctgcttgtttggagttggta
acagagttctcaccgaagcttcgtcaggtcatgctgaatgagatgttgcttttggatatt
catacacacgaagctgggacagggcaggcaggagagagaccgccatccgaccttataagt
agagtacgaggctatctggaaatgaggcttcctgatattcctcttcgtcaagttatagct
gaggaatgtgttgcctttatgttaaactggagagaaaatgaataccttacactccaagtt
cctgcatttttgcttcagagtaatccatatgtaaagcttggacagcttttagcagctaca
tgcaaagaacttccaggccctaaagaaagtagacggactgccaaagacctttgggaagtt
gttgttcaaatctgtagtgtgtccagtcagcacaaacgaggaaatgatggcagagttagt
ttaataaaacagagggaatctacgttaggtatcatgtatcggagtgaactgctttctttt
atcaaaaaattacgagaaccactcgttttgactattattttatcactctttgtgaaactt
cacaatgttcgggaggacattgtgaatgatattacagctgaacacatttctatttggcca
tcttccattcccaacctccagtctgtggactttgaagctgtggcaatcacagtgaaagag
ctagttcgatatacactcagtataaatccaaataaccattcttggttaattatccaggca
gatatttactttgcaacgaatcagtattcagcagctcttcactattacctccaggcagga
gctgtgtgttctgacttctttaacaaggctgtgccccctgatgtttatacagaccaggta
ataaaacgaatgataaaatgttgttctttgctgaattgccacacacaggtggccatttta
tgtcagttcctcagagaaattgactacaaaacagcgtttaaatctctgcaagaacaaaac
agtcatgatgctatggactcctactacgactacatatgggatgttaccattttggaatac
ttgacttatcttcatcataaaagaggagaaacagataaaagacaaattgcaatcaaagcc
atcggccagacagagttgaatgcaagcaatccagaagaagtgttacagctggcagcgcag
agaaggaaaaaaaagtttctccaagcaatggcaaaactttacttttaa

DBGET integrated database retrieval system