KEGG   Homo sapiens (human): 55658Help
Entry
55658             CDS       T01001                                 

Gene name
RNF126
Definition
(RefSeq) ring finger protein 126
  KO
K11982  E3 ubiquitin-protein ligase RNF115/126 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     55658 (RNF126)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab associated proteins
    55658 (RNF126)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    55658 (RNF126)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-RING_2 zf-C3HC4_2 zf-RING_11 zinc_ribbon_9 zf-RING_UBOX zf-C3HC4 zf-rbx1 zf-C3HC4_3 zf-RING_5 zf-ANAPC11 Prok-RING_4 zf-RING-like Rad50_zn_hook zf-Nse
Motif
Other DBs
NCBI-GeneID: 55658
NCBI-ProteinID: NP_001352947
OMIM: 615177
HGNC: 21151
Ensembl: ENSG00000070423
Vega: OTTHUMG00000180592
Pharos: Q9BV68(Tbio)
Structure
PDB: 

Position
19p13.3
AA seq 284 aa AA seqDB search
MAEASPHPGRYFCHCCSVEIVPRLPDYICPRCESGFIEELPEETRSTENGSAPSTAPTDQ
SRPPLEHVDQHLFTLPQGYGQFAFGIFDDSFEIPTFPPGAQADDGRDPESRRERDHPSRH
RIIQQLVNGIITPATIPSLGPWGVLHSNPMDYAWGANGLDAIITQLLNQFENTGPPPADK
EKIQALPTVPVTEEHVGSGLECPVCKDDYALGERVRQLPCNHLFHDGCIVPWLEQHDSCP
VCRKSLTGQNTATNPPGLTGVSFSSSSSSSSSSSPSNENATSNS
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggcgtcgccgcatcccggacggtacttctgccactgctgctccgtggagatc
gtcccgcgcctgccggattatatctgtccaagatgcgagtctggttttatcgaggagctt
ccggaagagaccaggagcacagaaaatggttctgccccctccacagctcccacagaccag
agccggccaccgttggagcacgtggaccagcacctgttcacgctgccgcagggctacgga
cagtttgctttcggcatcttcgatgacagcttcgagatccccacgttccctcctggggcg
caggctgacgacggcagggaccctgagagccggcgggagagagaccatccgtcccggcac
cggatcatccagcagctcgtcaacggcatcatcacgcccgccaccatccccagcctgggc
ccctggggagtcctgcactcaaaccctatggactacgcctggggggccaacggcctggat
gccatcatcacacagctcctcaatcagtttgaaaacacaggccccccaccggcagataaa
gagaaaatccaggccctccccaccgtccccgtcactgaggagcacgtaggctccgggctc
gagtgccctgtgtgcaaggacgactacgcgctgggtgagcgtgtgcggcagctgccctgc
aaccacctgttccacgacggctgcatcgtgccctggctggagcagcacgacagctgcccc
gtctgccgaaaaagcctcacgggacagaacacggccacgaacccccctggcctcactggg
gtgagcttctcctcctcgtcgtcatcgtcctcctccagctcgcccagcaacgagaacgcc
acaagcaactcgtga

DBGET integrated database retrieval system