KEGG   Homo sapiens (human): 5566Help
Entry
5566              CDS       T01001                                 

Gene name
PRKACA, PKACA, PPNAD4
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit alpha
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04020  Calcium signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04114  Oocyte meiosis
hsa04140  Autophagy - animal
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04270  Vascular smooth muscle contraction
hsa04310  Wnt signaling pathway
hsa04340  Hedgehog signaling pathway
hsa04371  Apelin signaling pathway
hsa04530  Tight junction
hsa04540  Gap junction
hsa04611  Platelet activation
hsa04713  Circadian entrainment
hsa04714  Thermogenesis
hsa04720  Long-term potentiation
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04727  GABAergic synapse
hsa04728  Dopaminergic synapse
hsa04740  Olfactory transduction
hsa04742  Taste transduction
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04910  Insulin signaling pathway
hsa04911  Insulin secretion
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04914  Progesterone-mediated oocyte maturation
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04918  Thyroid hormone synthesis
hsa04919  Thyroid hormone signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04924  Renin secretion
hsa04925  Aldosterone synthesis and secretion
hsa04926  Relaxin signaling pathway
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04934  Cushing's syndrome
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa04962  Vasopressin-regulated water reabsorption
hsa04970  Salivary secretion
hsa04971  Gastric acid secretion
hsa04976  Bile secretion
hsa05012  Parkinson's disease
hsa05020  Prion diseases
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05032  Morphine addiction
hsa05034  Alcoholism
hsa05110  Vibrio cholerae infection
hsa05146  Amoebiasis
hsa05165  Human papillomavirus infection
hsa05166  HTLV-I infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05205  Proteoglycans in cancer
hsa05414  Dilated cardiomyopathy (DCM)
Module
hsa_M00695  cAMP signaling
Network
N00271  HCV NS3 to host-cell-protein inhibition
N00288  PTH-PTH1R-PKA signaling pathway
N00297  ACTH-cortisol signaling pathway
N00298  CYP11B1-CYP11B2 fusion to ACTH-cortisol signaling pathway
N00320  Mutation-activated PRKACA to ACTH-cortisol signaling pathway
N00321  Mutation-activated GNAS to ACTH-cortisol signaling pathway
N00322  Mutation-inactivated PRKAR1A to ACTH-cortisol signaling pathway
N00323  Mutation-inactivated PDE11A/PDE8B to ACTH-cortisol signaling pathway
N00324  CRHR-PKA-ACTH signaling pathway
N00325  Mutation-inactivated RASD1 to CRHR-PKA-ACTH signaling pathway
N00326  Mutation-activated GNAS to CRHR-PKA-ACTH signaling pathway
N00327  Mutation-inactivated PRKAR1A to CRHR-PKA-ACTH signaling pathway
Disease
H01431  Cushing's syndrome
H02049  Bilateral macronodular adrenal hyperplasia (BMAH)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5566 (PRKACA)
   04010 MAPK signaling pathway
    5566 (PRKACA)
   04310 Wnt signaling pathway
    5566 (PRKACA)
   04340 Hedgehog signaling pathway
    5566 (PRKACA)
   04371 Apelin signaling pathway
    5566 (PRKACA)
   04020 Calcium signaling pathway
    5566 (PRKACA)
   04024 cAMP signaling pathway
    5566 (PRKACA)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    5566 (PRKACA)
  Cell growth and death
   04114 Oocyte meiosis
    5566 (PRKACA)
  Cellular community - eukaryotes
   04530 Tight junction
    5566 (PRKACA)
   04540 Gap junction
    5566 (PRKACA)
 Organismal Systems
  Immune system
   04611 Platelet activation
    5566 (PRKACA)
   04062 Chemokine signaling pathway
    5566 (PRKACA)
  Endocrine system
   04911 Insulin secretion
    5566 (PRKACA)
   04910 Insulin signaling pathway
    5566 (PRKACA)
   04922 Glucagon signaling pathway
    5566 (PRKACA)
   04923 Regulation of lipolysis in adipocyte
    5566 (PRKACA)
   04912 GnRH signaling pathway
    5566 (PRKACA)
   04913 Ovarian Steroidogenesis
    5566 (PRKACA)
   04915 Estrogen signaling pathway
    5566 (PRKACA)
   04914 Progesterone-mediated oocyte maturation
    5566 (PRKACA)
   04921 Oxytocin signaling pathway
    5566 (PRKACA)
   04926 Relaxin signaling pathway
    5566 (PRKACA)
   04918 Thyroid hormone synthesis
    5566 (PRKACA)
   04919 Thyroid hormone signaling pathway
    5566 (PRKACA)
   04928 Parathyroid hormone synthesis, secretion and action
    5566 (PRKACA)
   04916 Melanogenesis
    5566 (PRKACA)
   04924 Renin secretion
    5566 (PRKACA)
   04925 Aldosterone synthesis and secretion
    5566 (PRKACA)
   04927 Cortisol synthesis and secretion
    5566 (PRKACA)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5566 (PRKACA)
   04270 Vascular smooth muscle contraction
    5566 (PRKACA)
  Digestive system
   04970 Salivary secretion
    5566 (PRKACA)
   04971 Gastric acid secretion
    5566 (PRKACA)
   04976 Bile secretion
    5566 (PRKACA)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    5566 (PRKACA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    5566 (PRKACA)
  Nervous system
   04724 Glutamatergic synapse
    5566 (PRKACA)
   04727 GABAergic synapse
    5566 (PRKACA)
   04725 Cholinergic synapse
    5566 (PRKACA)
   04728 Dopaminergic synapse
    5566 (PRKACA)
   04726 Serotonergic synapse
    5566 (PRKACA)
   04720 Long-term potentiation
    5566 (PRKACA)
   04723 Retrograde endocannabinoid signaling
    5566 (PRKACA)
  Sensory system
   04740 Olfactory transduction
    5566 (PRKACA)
   04742 Taste transduction
    5566 (PRKACA)
   04750 Inflammatory mediator regulation of TRP channels
    5566 (PRKACA)
  Aging
   04211 Longevity regulating pathway - mammal
    5566 (PRKACA)
   04213 Longevity regulating pathway - multiple species
    5566 (PRKACA)
  Environmental adaptation
   04713 Circadian entrainment
    5566 (PRKACA)
   04714 Thermogenesis
    5566 (PRKACA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5566 (PRKACA)
   05205 Proteoglycans in cancer
    5566 (PRKACA)
   05203 Viral carcinogenesis
    5566 (PRKACA)
  Neurodegenerative diseases
   05012 Parkinson's disease
    5566 (PRKACA)
   05020 Prion diseases
    5566 (PRKACA)
  Substance dependence
   05030 Cocaine addiction
    5566 (PRKACA)
   05031 Amphetamine addiction
    5566 (PRKACA)
   05032 Morphine addiction
    5566 (PRKACA)
   05034 Alcoholism
    5566 (PRKACA)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    5566 (PRKACA)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    5566 (PRKACA)
  Infectious diseases
   05110 Vibrio cholerae infection
    5566 (PRKACA)
   05166 HTLV-I infection
    5566 (PRKACA)
   05163 Human cytomegalovirus infection
    5566 (PRKACA)
   05169 Epstein-Barr virus infection
    5566 (PRKACA)
   05165 Human papillomavirus infection
    5566 (PRKACA)
   05146 Amoebiasis
    5566 (PRKACA)
  Drug resistance
   01522 Endocrine resistance
    5566 (PRKACA)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     5566 (PRKACA)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  PKA family
   5566 (PRKACA)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     5566 (PRKACA)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    5566 (PRKACA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 5566
NCBI-ProteinID: NP_002721
OMIM: 601639
HGNC: 9380
Ensembl: ENSG00000072062
Vega: OTTHUMG00000182051
Pharos: P17612(Tchem)
UniProt: P17612 A0A024R7J0
Structure
PDB: 

Position
19p13.12
AA seq 351 aa AA seqDB search
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVML
VKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacgccgccgccgccaagaagggcagcgagcaggagagcgtgaaagaattctta
gccaaagccaaagaagattttcttaaaaaatgggaaagtcccgctcagaacacagcccac
ttggatcagtttgaacgaatcaagaccctcggcacgggctccttcgggcgggtgatgctg
gtgaaacacaaggagaccgggaaccactatgccatgaagatcctcgacaaacagaaggtg
gtgaaactgaaacagatcgaacacaccctgaatgaaaagcgcatcctgcaagctgtcaac
tttccgttcctcgtcaaactcgagttctccttcaaggacaactcaaacttatacatggtc
atggagtacgtgcccggcggggagatgttctcacacctacggcggatcggaaggttcagt
gagccccatgcccgtttctacgcggcccagatcgtcctgacctttgagtatctgcactcg
ctggatctcatctacagggacctgaagccggagaatctgctcattgaccagcagggctac
attcaggtgacagacttcggtttcgccaagcgcgtgaagggccgcacttggaccttgtgc
ggcacccctgagtacctggcccctgagattatcctgagcaaaggctacaacaaggccgtg
gactggtgggccctgggggttcttatctatgaaatggccgctggctacccgcccttcttc
gcagaccagcccatccagatctatgagaagatcgtctctgggaaggtgcgcttcccttcc
cacttcagctctgacttgaaggacctgctgcggaacctcctgcaggtagatctcaccaag
cgctttgggaacctcaagaatggggtcaacgatatcaagaaccacaagtggtttgccaca
actgactggattgccatctaccagaggaaggtggaagctcccttcataccaaagtttaaa
ggccctggggatacgagtaactttgacgactatgaggaagaagaaatccgggtctccatc
aatgagaagtgtggcaaggagttttctgagttttag

KEGG   Homo sapiens (human): 5567Help
Entry
5567              CDS       T01001                                 

Gene name
PRKACB, PKA_C-beta, PKACB
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit beta
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04020  Calcium signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04114  Oocyte meiosis
hsa04140  Autophagy - animal
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04270  Vascular smooth muscle contraction
hsa04310  Wnt signaling pathway
hsa04340  Hedgehog signaling pathway
hsa04371  Apelin signaling pathway
hsa04530  Tight junction
hsa04540  Gap junction
hsa04611  Platelet activation
hsa04713  Circadian entrainment
hsa04714  Thermogenesis
hsa04720  Long-term potentiation
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04727  GABAergic synapse
hsa04728  Dopaminergic synapse
hsa04740  Olfactory transduction
hsa04742  Taste transduction
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04910  Insulin signaling pathway
hsa04911  Insulin secretion
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04914  Progesterone-mediated oocyte maturation
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04918  Thyroid hormone synthesis
hsa04919  Thyroid hormone signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04924  Renin secretion
hsa04925  Aldosterone synthesis and secretion
hsa04926  Relaxin signaling pathway
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04934  Cushing's syndrome
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa04962  Vasopressin-regulated water reabsorption
hsa04970  Salivary secretion
hsa04971  Gastric acid secretion
hsa04976  Bile secretion
hsa05012  Parkinson's disease
hsa05020  Prion diseases
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05032  Morphine addiction
hsa05110  Vibrio cholerae infection
hsa05146  Amoebiasis
hsa05165  Human papillomavirus infection
hsa05166  HTLV-I infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05205  Proteoglycans in cancer
hsa05414  Dilated cardiomyopathy (DCM)
Module
hsa_M00695  cAMP signaling
Network
N00271  HCV NS3 to host-cell-protein inhibition
N00288  PTH-PTH1R-PKA signaling pathway
N00297  ACTH-cortisol signaling pathway
N00298  CYP11B1-CYP11B2 fusion to ACTH-cortisol signaling pathway
N00321  Mutation-activated GNAS to ACTH-cortisol signaling pathway
N00324  CRHR-PKA-ACTH signaling pathway
N00325  Mutation-inactivated RASD1 to CRHR-PKA-ACTH signaling pathway
N00326  Mutation-activated GNAS to CRHR-PKA-ACTH signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5567 (PRKACB)
   04010 MAPK signaling pathway
    5567 (PRKACB)
   04310 Wnt signaling pathway
    5567 (PRKACB)
   04340 Hedgehog signaling pathway
    5567 (PRKACB)
   04371 Apelin signaling pathway
    5567 (PRKACB)
   04020 Calcium signaling pathway
    5567 (PRKACB)
   04024 cAMP signaling pathway
    5567 (PRKACB)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    5567 (PRKACB)
  Cell growth and death
   04114 Oocyte meiosis
    5567 (PRKACB)
  Cellular community - eukaryotes
   04530 Tight junction
    5567 (PRKACB)
   04540 Gap junction
    5567 (PRKACB)
 Organismal Systems
  Immune system
   04611 Platelet activation
    5567 (PRKACB)
   04062 Chemokine signaling pathway
    5567 (PRKACB)
  Endocrine system
   04911 Insulin secretion
    5567 (PRKACB)
   04910 Insulin signaling pathway
    5567 (PRKACB)
   04922 Glucagon signaling pathway
    5567 (PRKACB)
   04923 Regulation of lipolysis in adipocyte
    5567 (PRKACB)
   04912 GnRH signaling pathway
    5567 (PRKACB)
   04913 Ovarian Steroidogenesis
    5567 (PRKACB)
   04915 Estrogen signaling pathway
    5567 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    5567 (PRKACB)
   04921 Oxytocin signaling pathway
    5567 (PRKACB)
   04926 Relaxin signaling pathway
    5567 (PRKACB)
   04918 Thyroid hormone synthesis
    5567 (PRKACB)
   04919 Thyroid hormone signaling pathway
    5567 (PRKACB)
   04928 Parathyroid hormone synthesis, secretion and action
    5567 (PRKACB)
   04916 Melanogenesis
    5567 (PRKACB)
   04924 Renin secretion
    5567 (PRKACB)
   04925 Aldosterone synthesis and secretion
    5567 (PRKACB)
   04927 Cortisol synthesis and secretion
    5567 (PRKACB)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5567 (PRKACB)
   04270 Vascular smooth muscle contraction
    5567 (PRKACB)
  Digestive system
   04970 Salivary secretion
    5567 (PRKACB)
   04971 Gastric acid secretion
    5567 (PRKACB)
   04976 Bile secretion
    5567 (PRKACB)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    5567 (PRKACB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    5567 (PRKACB)
  Nervous system
   04724 Glutamatergic synapse
    5567 (PRKACB)
   04727 GABAergic synapse
    5567 (PRKACB)
   04725 Cholinergic synapse
    5567 (PRKACB)
   04728 Dopaminergic synapse
    5567 (PRKACB)
   04726 Serotonergic synapse
    5567 (PRKACB)
   04720 Long-term potentiation
    5567 (PRKACB)
   04723 Retrograde endocannabinoid signaling
    5567 (PRKACB)
  Sensory system
   04740 Olfactory transduction
    5567 (PRKACB)
   04742 Taste transduction
    5567 (PRKACB)
   04750 Inflammatory mediator regulation of TRP channels
    5567 (PRKACB)
  Aging
   04211 Longevity regulating pathway - mammal
    5567 (PRKACB)
   04213 Longevity regulating pathway - multiple species
    5567 (PRKACB)
  Environmental adaptation
   04713 Circadian entrainment
    5567 (PRKACB)
   04714 Thermogenesis
    5567 (PRKACB)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5567 (PRKACB)
   05205 Proteoglycans in cancer
    5567 (PRKACB)
   05203 Viral carcinogenesis
    5567 (PRKACB)
  Neurodegenerative diseases
   05012 Parkinson's disease
    5567 (PRKACB)
   05020 Prion diseases
    5567 (PRKACB)
  Substance dependence
   05030 Cocaine addiction
    5567 (PRKACB)
   05031 Amphetamine addiction
    5567 (PRKACB)
   05032 Morphine addiction
    5567 (PRKACB)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    5567 (PRKACB)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    5567 (PRKACB)
  Infectious diseases
   05110 Vibrio cholerae infection
    5567 (PRKACB)
   05166 HTLV-I infection
    5567 (PRKACB)
   05163 Human cytomegalovirus infection
    5567 (PRKACB)
   05169 Epstein-Barr virus infection
    5567 (PRKACB)
   05165 Human papillomavirus infection
    5567 (PRKACB)
   05146 Amoebiasis
    5567 (PRKACB)
  Drug resistance
   01522 Endocrine resistance
    5567 (PRKACB)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     5567 (PRKACB)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  PKA family
   5567 (PRKACB)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     5567 (PRKACB)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    5567 (PRKACB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 5567
NCBI-ProteinID: NP_002722
OMIM: 176892
HGNC: 9381
Ensembl: ENSG00000142875
Vega: OTTHUMG00000009975
Pharos: P22694(Tchem)
UniProt: P22694 B2RB89
Position
1p31.1
AA seq 351 aa AA seqDB search
MGNAATAKKGSEVESVKEFLAKAKEDFLKKWENPTQNNAGLEDFERKKTLGTGSFGRVML
VKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFAT
TDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDIRVSITEKCAKEFGEF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggggaacgcggcgaccgccaagaaaggcagcgaggtggagagcgtgaaagagtttcta
gccaaagccaaagaagactttttgaaaaaatgggagaatccaactcagaataatgccgga
cttgaagattttgaaaggaaaaaaacccttggaacaggttcatttggaagagtcatgttg
gtaaaacacaaagccactgaacagtattatgccatgaagatcttagataagcagaaggtt
gttaaactgaagcaaatagagcatactttgaatgagaaaagaatattacaggcagtgaat
tttcctttccttgttcgactggagtatgcttttaaggataattctaatttatacatggtt
atggaatatgtccctgggggtgaaatgttttcacatctaagaagaattggaaggttcagt
gagccccatgcacggttctatgcagctcagatagtgctaacattcgagtacctccattca
ctagacctcatctacagagatctaaaacctgaaaatctcttaattgaccatcaaggctat
atccaggtcacagactttgggtttgccaaaagagttaaaggcagaacttggacattatgt
ggaactccagagtatttggctccagaaataattctcagcaagggctacaataaggcagtg
gattggtgggcattaggagtgctaatctatgaaatggcagctggctatcccccattcttt
gcagaccaaccaattcagatttatgaaaagattgtttctggaaaggtccgattcccatcc
cacttcagttcagatctcaaggaccttctacggaacctgctgcaggtggatttgaccaag
agatttggaaatctaaagaatggtgtcagtgatataaaaactcacaagtggtttgccacg
acagattggattgctatttaccagaggaaggttgaagctccattcataccaaagtttaga
ggctctggagataccagcaactttgatgactatgaagaagaagatatccgtgtctctata
acagaaaaatgtgcaaaagaatttggtgaattttaa

KEGG   Homo sapiens (human): 5568Help
Entry
5568              CDS       T01001                                 

Gene name
PRKACG, BDPLT19, KAPG, PKACg
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit gamma
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04020  Calcium signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04114  Oocyte meiosis
hsa04140  Autophagy - animal
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04270  Vascular smooth muscle contraction
hsa04310  Wnt signaling pathway
hsa04340  Hedgehog signaling pathway
hsa04371  Apelin signaling pathway
hsa04530  Tight junction
hsa04540  Gap junction
hsa04611  Platelet activation
hsa04713  Circadian entrainment
hsa04714  Thermogenesis
hsa04720  Long-term potentiation
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04727  GABAergic synapse
hsa04728  Dopaminergic synapse
hsa04740  Olfactory transduction
hsa04742  Taste transduction
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04910  Insulin signaling pathway
hsa04911  Insulin secretion
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04914  Progesterone-mediated oocyte maturation
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04918  Thyroid hormone synthesis
hsa04919  Thyroid hormone signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04924  Renin secretion
hsa04925  Aldosterone synthesis and secretion
hsa04926  Relaxin signaling pathway
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04934  Cushing's syndrome
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa04962  Vasopressin-regulated water reabsorption
hsa04970  Salivary secretion
hsa04971  Gastric acid secretion
hsa04976  Bile secretion
hsa05012  Parkinson's disease
hsa05020  Prion diseases
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05032  Morphine addiction
hsa05110  Vibrio cholerae infection
hsa05146  Amoebiasis
hsa05165  Human papillomavirus infection
hsa05166  HTLV-I infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05205  Proteoglycans in cancer
hsa05414  Dilated cardiomyopathy (DCM)
Module
hsa_M00695  cAMP signaling
Network
N00271  HCV NS3 to host-cell-protein inhibition
N00288  PTH-PTH1R-PKA signaling pathway
N00297  ACTH-cortisol signaling pathway
N00298  CYP11B1-CYP11B2 fusion to ACTH-cortisol signaling pathway
N00321  Mutation-activated GNAS to ACTH-cortisol signaling pathway
N00324  CRHR-PKA-ACTH signaling pathway
N00325  Mutation-inactivated RASD1 to CRHR-PKA-ACTH signaling pathway
N00326  Mutation-activated GNAS to CRHR-PKA-ACTH signaling pathway
Disease
H01740  Macrothrombocytopenia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5568 (PRKACG)
   04010 MAPK signaling pathway
    5568 (PRKACG)
   04310 Wnt signaling pathway
    5568 (PRKACG)
   04340 Hedgehog signaling pathway
    5568 (PRKACG)
   04371 Apelin signaling pathway
    5568 (PRKACG)
   04020 Calcium signaling pathway
    5568 (PRKACG)
   04024 cAMP signaling pathway
    5568 (PRKACG)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    5568 (PRKACG)
  Cell growth and death
   04114 Oocyte meiosis
    5568 (PRKACG)
  Cellular community - eukaryotes
   04530 Tight junction
    5568 (PRKACG)
   04540 Gap junction
    5568 (PRKACG)
 Organismal Systems
  Immune system
   04611 Platelet activation
    5568 (PRKACG)
   04062 Chemokine signaling pathway
    5568 (PRKACG)
  Endocrine system
   04911 Insulin secretion
    5568 (PRKACG)
   04910 Insulin signaling pathway
    5568 (PRKACG)
   04922 Glucagon signaling pathway
    5568 (PRKACG)
   04923 Regulation of lipolysis in adipocyte
    5568 (PRKACG)
   04912 GnRH signaling pathway
    5568 (PRKACG)
   04913 Ovarian Steroidogenesis
    5568 (PRKACG)
   04915 Estrogen signaling pathway
    5568 (PRKACG)
   04914 Progesterone-mediated oocyte maturation
    5568 (PRKACG)
   04921 Oxytocin signaling pathway
    5568 (PRKACG)
   04926 Relaxin signaling pathway
    5568 (PRKACG)
   04918 Thyroid hormone synthesis
    5568 (PRKACG)
   04919 Thyroid hormone signaling pathway
    5568 (PRKACG)
   04928 Parathyroid hormone synthesis, secretion and action
    5568 (PRKACG)
   04916 Melanogenesis
    5568 (PRKACG)
   04924 Renin secretion
    5568 (PRKACG)
   04925 Aldosterone synthesis and secretion
    5568 (PRKACG)
   04927 Cortisol synthesis and secretion
    5568 (PRKACG)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5568 (PRKACG)
   04270 Vascular smooth muscle contraction
    5568 (PRKACG)
  Digestive system
   04970 Salivary secretion
    5568 (PRKACG)
   04971 Gastric acid secretion
    5568 (PRKACG)
   04976 Bile secretion
    5568 (PRKACG)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    5568 (PRKACG)
   04961 Endocrine and other factor-regulated calcium reabsorption
    5568 (PRKACG)
  Nervous system
   04724 Glutamatergic synapse
    5568 (PRKACG)
   04727 GABAergic synapse
    5568 (PRKACG)
   04725 Cholinergic synapse
    5568 (PRKACG)
   04728 Dopaminergic synapse
    5568 (PRKACG)
   04726 Serotonergic synapse
    5568 (PRKACG)
   04720 Long-term potentiation
    5568 (PRKACG)
   04723 Retrograde endocannabinoid signaling
    5568 (PRKACG)
  Sensory system
   04740 Olfactory transduction
    5568 (PRKACG)
   04742 Taste transduction
    5568 (PRKACG)
   04750 Inflammatory mediator regulation of TRP channels
    5568 (PRKACG)
  Aging
   04211 Longevity regulating pathway - mammal
    5568 (PRKACG)
   04213 Longevity regulating pathway - multiple species
    5568 (PRKACG)
  Environmental adaptation
   04713 Circadian entrainment
    5568 (PRKACG)
   04714 Thermogenesis
    5568 (PRKACG)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5568 (PRKACG)
   05205 Proteoglycans in cancer
    5568 (PRKACG)
   05203 Viral carcinogenesis
    5568 (PRKACG)
  Neurodegenerative diseases
   05012 Parkinson's disease
    5568 (PRKACG)
   05020 Prion diseases
    5568 (PRKACG)
  Substance dependence
   05030 Cocaine addiction
    5568 (PRKACG)
   05031 Amphetamine addiction
    5568 (PRKACG)
   05032 Morphine addiction
    5568 (PRKACG)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    5568 (PRKACG)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    5568 (PRKACG)
  Infectious diseases
   05110 Vibrio cholerae infection
    5568 (PRKACG)
   05166 HTLV-I infection
    5568 (PRKACG)
   05163 Human cytomegalovirus infection
    5568 (PRKACG)
   05169 Epstein-Barr virus infection
    5568 (PRKACG)
   05165 Human papillomavirus infection
    5568 (PRKACG)
   05146 Amoebiasis
    5568 (PRKACG)
  Drug resistance
   01522 Endocrine resistance
    5568 (PRKACG)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     5568 (PRKACG)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  PKA family
   5568 (PRKACG)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     5568 (PRKACG)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    5568 (PRKACG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Haspin_kinase Kdo RIO1
Motif
Other DBs
NCBI-GeneID: 5568
NCBI-ProteinID: NP_002723
OMIM: 176893
HGNC: 9382
Ensembl: ENSG00000165059
Vega: OTTHUMG00000019974
Pharos: P22612(Tbio)
UniProt: P22612
Position
9q21.11
AA seq 351 aa AA seqDB search
MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVML
VRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLV
MEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGY
LQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFY
ADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFAT
TSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacgcccccgccaagaaggacaccgagcaggaggagagcgtgaacgagttccta
gccaaagccagaggagatttcctctacagatggggaaaccccgctcaaaacaccgccagc
tcggatcagttcgaacggctcaggacgctgggcatgggctccttcgggcgggtgatgctg
gtgaggcaccaggagaccggcggccactacgccatgaagatcctcaacaagcagaaggtg
gtgaagatgaagcaggtcgagcacatactgaacgagaagcgcatcctgcaggcgatcgac
tttccgttcctcgtcaagctccagttctcctttaaggacaactcctacctgtacctggtg
atggagtacgtgccgggtggggagatgttctcccgcctacagcgcgtcggaaggtttagc
gagccccatgcctgtttctatgccgcccaggtcgtcctggccgtccagtacctacactcg
ctcgacctcatccaccgcgacctgaagcccgagaatctcctcatcgaccagcagggctac
ctgcaggtgacggacttcggtttcgccaagcgcgtgaagggccgcacttggaccttgtgc
gggaccccagagtacctggcccccgagatcatcctgagcaaaggctacaacaaggccgtg
gactggtgggccctaggggtgctcatctatgagatggccgtgggcttcccacccttctac
gccgaccagcccatccagatctacgagaagatcgtctctgggagggtgcggtttccctcc
aaactcagctctgacctcaagcatctgctgcggagcctgctgcaggtggacctcaccaag
cgcttcggaaacctcaggaacggggttggcgacatcaagaaccacaagtggttcgccaca
accagctggatcgccatctatgagaagaaggtggaagctcccttcatcccgaagtacaca
ggccctggggatgccagtaactttgacgactacgaggaggaagagctccggatctccatc
aatgagaagtgtgccaaggagttttctgagttttag

DBGET integrated database retrieval system