KEGG   Homo sapiens (human): 55662
Entry
55662             CDS       T01001                                 

Gene name
HIF1AN, FIH1
Definition
(RefSeq) hypoxia inducible factor 1 subunit alpha inhibitor
  KO
K18055  hypoxia-inducible factor 1-alpha inhibitor (HIF hydroxylase) [EC:1.14.11.30]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    55662 (HIF1AN)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.30  hypoxia-inducible factor-asparagine dioxygenase
     55662 (HIF1AN)
SSDB
Motif
Pfam: Cupin_8 Cupin_4 JmjC Cupin_2
Other DBs
NCBI-GeneID: 55662
NCBI-ProteinID: NP_060372
OMIM: 606615
HGNC: 17113
Ensembl: ENSG00000166135
Vega: OTTHUMG00000018911
Pharos: Q9NWT6(Tbio)
UniProt: Q9NWT6
Structure
PDB: 

Position
10q24.31
AA seq 349 aa
MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEE
PVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNR
EEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWG
QLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQS
QVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGA
PTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
NT seq 1050 nt   +upstreamnt  +downstreamnt
atggcggcgacagcggcggaggctgtggcctctggctctggagagccccgggaggaggct
ggagccctcggccccgcctgggatgaatcccagttgcgcagttatagcttcccgactagg
cccattccgcgtctgagtcagagcgacccccgggcagaggagcttattgagaatgaggag
cctgtggtgctgaccgacacaaatcttgtgtatcctgccctgaaatgggaccttgaatac
ctgcaagagaatattggcaatggagacttctctgtgtacagtgccagcacccacaagttc
ttgtactatgatgagaagaagatggccaatttccagaactttaagccgaggtccaacagg
gaagaaatgaaatttcatgagttcgttgagaaactgcaggatatacagcagcgaggaggg
gaagagaggttgtatctgcagcaaacgctcaatgacactgtgggcaggaagattgtcatg
gacttcttaggttttaactggaactggattaataagcaacagggaaagcgtggctggggg
cagcttacctctaacctgctgctcattggcatggaaggaaatgtgacacctgctcactat
gatgagcagcagaacttttttgctcagataaaaggttacaaacgatgcatcttattccct
ccggatcagttcgagtgcctctacccataccctgttcatcacccatgtgacagacagagc
caggtggactttgacaatcccgactacgagaggttccctaatttccaaaatgtggttggt
tacgaaacagtggttggccctggtgatgttctttacatcccaatgtactggtggcatcac
atagagtcattactaaatggggggattaccatcactgtgaacttctggtataagggggct
cccacccctaagagaattgaatatcctctcaaagctcatcagaaagtggccataatgaga
aacattgagaagatgcttggagaggccttggggaacccacaagaggtggggcccttgttg
aacacaatgatcaagggccgatacaactag

DBGET integrated database retrieval system