KEGG   Homo sapiens (human): 55666
Entry
55666             CDS       T01001                                 

Symbol
NPLOC4, NPL4
Name
(RefSeq) NPL4 homolog, ubiquitin recognition factor
  KO
K14015  nuclear protein localization protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    55666 (NPLOC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hsa03009]
    55666 (NPLOC4)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  Pre-60S particles
   Ribosome quality control complex
    55666 (NPLOC4)
SSDB
Motif
Pfam: NPL4 zf-NPL4 UN_NPL4 zf-RanBP
Other DBs
NCBI-GeneID: 55666
NCBI-ProteinID: NP_060391
OMIM: 606590
HGNC: 18261
Ensembl: ENSG00000182446
Vega: OTTHUMG00000177990
Pharos: Q8TAT6(Tbio)
UniProt: Q8TAT6 A0A024R8R4
Position
17q25.3
AA seq 608 aa
MAESIIIRVQSPDGVKRITATKRETAATFLKKVAKEFGFQNNGFSVYINRNKTGEITASS
NKSLNLLKIKHGDLLFLFPSSLAGPSSEMETSVPPGFKVFGAPNVVEDEIDQYLSKQDGK
IYRSRDPQLCRHGPLGKCVHCVPLEPFDEDYLNHLEPPVKHMSFHAYIRKLTGGADKGKF
VALENISCKIKSGCEGHLPWPNGICTKCQPSAITLNRQKYRHVDNIMFENHTVADRFLDF
WRKTGNQHFGYLYGRYTEHKDIPLGIRAEVAAIYEPPQIGTQNSLELLEDPKAEVVDEIA
AKLGLRKVGWIFTDLVSEDTRKGTVRYSRNKDTYFLSSEECITAGDFQNKHPNMCRLSPD
GHFGSKFVTAVATGGPDNQVHFEGYQVSNQCMALVRDECLLPCKDAPELGYAKESSSEQY
VPDVFYKDVDKFGNEITQLARPLPVEYLIIDITTTFPKDPVYTFSISQNPFPIENRDVLG
ETQDFHSLATYLSQNTSSVFLDTISDFHLLLFLVTNEVMPLQDSISLLLEAVRTRNEELA
QTWKRSEQWATIEQLCSTVGGQLPGLHEYGAVGGSTHTATAAMWACQHCTFMNQPGTGHC
EMCSLPRT
NT seq 1827 nt   +upstreamnt  +downstreamnt
atggccgagagcatcataattcgtgtccagtccccggatggagtgaagcggatcacagca
acaaagagagaaacagcagcaacatttttgaaaaaggttgcaaaggagtttggcttccaa
aataatggcttctcggtttacatcaatagaaacaagaccggagagataacagcctcctcc
aacaaatccctcaacttgctaaaaatcaagcatggcgatttgttgttcctgtttccctcg
agccttgctgggccctcatctgaaatggagacgtcagttccaccgggcttcaaagtcttt
ggcgctcccaacgtggtggaggatgagattgatcagtacctcagcaaacaggacgggaag
atttacagaagccgagacccacagctatgccgccacggccctttggggaaatgcgtgcac
tgcgtccctctagagccattcgatgaggactatctaaaccatctcgagcctcccgtgaag
cacatgtccttccacgcctacatccggaagctgactggaggggctgacaaggggaagttt
gttgccctggagaacatcagctgcaagattaagtcagggtgcgaggggcacctcccgtgg
ccgaatggcatctgtactaagtgccagccgagcgccatcacgctgaacagacagaagtac
aggcatgtggacaatatcatgtttgagaatcacaccgtcgctgaccgctttcttgacttc
tggagaaagacagggaaccagcattttgggtacttatacggacggtacacggagcacaaa
gacattccccttggcatcagggctgaagtggctgcgatttatgagccacctcagattggt
acacagaacagcttggagcttcttgaggatccaaaagctgaagtggtcgatgaaattgct
gccaaacttggcctgcggaaggttggctggatatttacagacctcgtctcagaagatacc
cgaaagggtaccgtccgctacagtcgaaataaggacacctatttcctaagttcagaagag
tgcatcactgcaggagacttccagaacaagcatcccaacatgtgccggctctctccagac
ggacattttggatccaagtttgttactgcagtggctacaggtggtcctgacaaccaagtc
cactttgaagggtaccaggtgtccaatcagtgtatggcactggtccgtgatgagtgtttg
ctgccatgcaaggacgccccggagcttggctacgccaaggagtctagcagtgagcagtac
gtgcctgatgtgttttataaggacgtagacaagtttggcaacgagatcacccagctggcc
cggcccctgcctgtggagtatctcatcatagacatcacaacaactttccccaaggatcca
gtttacactttttctatttcgcaaaatccatttcctattgaaaaccgggatgtattgggt
gagacacaggacttccatagcttggccacctatttgtctcagaatacctcatctgtgttc
ttggataccatctcagatttccacctcttgctgttcctggtcaccaatgaagttatgcct
ctgcaggacagcatcagcttgctgctggaggccgtgcggaccagaaatgaggagctcgcc
cagacatggaagaggtctgagcagtgggccaccatcgagcagctgtgcagcacagttggc
gggcagctcccaggtctccatgagtacggcgccgtcgggggctccacacacacggccact
gcagccatgtgggcctgtcagcactgcacgttcatgaaccagccaggcacaggccactgc
gagatgtgcagcctccccaggacctag

DBGET integrated database retrieval system