KEGG   Homo sapiens (human): 55676Help
Entry
55676             CDS       T01001                                 

Gene name
SLC30A6, MST103, MSTP103, ZNT6
Definition
(RefSeq) solute carrier family 30 member 6
  KO
K14693  solute carrier family 30 (zinc transporter), member 6
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    55676 (SLC30A6)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC30: Zinc efflux transporter
   55676 (SLC30A6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cation_efflux
Motif
Other DBs
NCBI-GeneID: 55676
NCBI-ProteinID: NP_060434
OMIM: 611148
HGNC: 19305
Ensembl: ENSG00000152683
Vega: OTTHUMG00000128456
Pharos: Q6NXT4(Tbio)
UniProt: Q6NXT4
Position
2p22.3
AA seq 461 aa AA seqDB search
MGTIHLFRKPQRSFFGKLLREFRLVAADRRSWKILLFGVINLICTGFLLMWCSSTNSIAL
TAYTYLTIFDLFSLMTCLISYWVTLRKPSPVYSFGFERLEVLAVFASTVLAQLGALFILK
ESAERFLEQPEIHTGRLLVGTFVALCFNLFTMLSIRNKPFAYVSEAASTSWLQEHVADLS
RSLCGIIPGLSSIFLPRMNPFVLIDLAGAFALCITYMLIEINNYFAVDTASAIAIALMTF
GTMYPMSVYSGKVLLQTTPPHVIGQLDKLIREVSTLDGVLEVRNEHFWTLGFGSLAGSVH
VRIRRDANEQMVLAHVTNRLYTLVSTLTVQIFKDDWIRPALLSGPVAANVLNFSDHHVIP
MPLLKGTDDLNPVTSTPAKPSSPPPEFSFNTPGKNVNPVILLNTQTRPYGFGLNHGHTPY
SSMLNQGLGVPGIGATQGLRTGFTNIPSRYGTNNRIGQPRP
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggggacaattcatctctttcgaaaaccacaaagatccttttttggcaagttgttacgg
gaatttagacttgtagcagctgaccgaaggtcctggaagatactgctctttggtgtaata
aacttgatatgtactggcttcctgcttatgtggtgcagttctactaatagtatagcttta
actgcctatacttacctgaccatttttgatctttttagtttaatgacatgtttaataagt
tactgggtaacattgaggaaacctagccctgtctattcatttgggtttgaaagattagaa
gtcctggctgtatttgcctccacagtcttggcacagttgggagctctctttatattaaaa
gaaagtgcagaacgctttttggaacagcccgagatacacacgggaagattattagttggt
acttttgtggctctttgtttcaacctgttcacgatgctttctattcggaataaacctttt
gcttatgtctcagaagctgctagtacgagctggcttcaagagcatgttgcagatcttagt
cgaagcttgtgtggaattattccgggacttagcagtatcttccttccccgaatgaatcca
tttgttttgattgatcttgctggagcatttgctctttgtattacatatatgctcattgaa
attaataattattttgccgtagacactgcctctgctatagctattgccttgatgacattt
ggcactatgtatcccatgagtgtgtacagtgggaaagtcttactccagacaacaccaccc
catgttattggtcagttggacaaactcatcagagaggtatctaccttagatggagtttta
gaagtccgaaatgaacatttttggaccctaggttttggctcattggctggatcagtgcat
gtaagaattcgacgagatgccaatgaacaaatggttcttgctcatgtgaccaacaggctg
tacactctagtgtctactctaactgttcaaattttcaaggatgactggattaggcctgcc
ttattgtctgggcctgttgcagccaatgtcctaaacttttcagatcatcacgtaatccca
atgcctcttttaaagggtactgatgatttgaacccagttacatcaactccagctaaacct
agtagtccacctccagaattttcatttaacactcctgggaaaaatgtgaacccagttatt
cttctaaacacacaaacaaggccttatggttttggtctcaatcatggacacacaccttac
agcagcatgcttaatcaaggacttggagttccaggaattggagcaactcaaggattgagg
actggttttacaaatataccaagtagatatggaactaataatagaattggacaaccaaga
ccatga

DBGET integrated database retrieval system