KEGG   Homo sapiens (human): 5568Help
Entry
5568              CDS       T01001                                 

Gene name
PRKACG, BDPLT19, KAPG, PKACg
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit gamma
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04020  Calcium signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04114  Oocyte meiosis
hsa04140  Autophagy - animal
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04270  Vascular smooth muscle contraction
hsa04310  Wnt signaling pathway
hsa04340  Hedgehog signaling pathway
hsa04371  Apelin signaling pathway
hsa04530  Tight junction
hsa04540  Gap junction
hsa04611  Platelet activation
hsa04713  Circadian entrainment
hsa04714  Thermogenesis
hsa04720  Long-term potentiation
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04727  GABAergic synapse
hsa04728  Dopaminergic synapse
hsa04740  Olfactory transduction
hsa04742  Taste transduction
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04910  Insulin signaling pathway
hsa04911  Insulin secretion
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04914  Progesterone-mediated oocyte maturation
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04918  Thyroid hormone synthesis
hsa04919  Thyroid hormone signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04924  Renin secretion
hsa04925  Aldosterone synthesis and secretion
hsa04926  Relaxin signaling pathway
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04934  Cushing syndrome
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa04962  Vasopressin-regulated water reabsorption
hsa04970  Salivary secretion
hsa04971  Gastric acid secretion
hsa04976  Bile secretion
hsa05012  Parkinson disease
hsa05020  Prion diseases
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05032  Morphine addiction
hsa05034  Alcoholism
hsa05110  Vibrio cholerae infection
hsa05146  Amoebiasis
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05205  Proteoglycans in cancer
hsa05414  Dilated cardiomyopathy (DCM)
Network
nt06124  Chemokine signaling (virus)
nt06167  Human cytomegalovirus (HCMV)
nt06310  CRH-ACTH-cortisol signaling
nt06318  CaSR-PTH signaling
nt06322  TSH-TG/TH-THR signaling
nt06360  Cushing syndrome
  Element
N00288  PTH-PTH1R-PKA signaling pathway
N00297  ACTH-cortisol signaling pathway
N00298  CYP11B1-CYP11B2 fusion to ACTH-cortisol signaling pathway
N00321  Mutation-activated GNAS to ACTH-cortisol signaling pathway
N00324  CRHR-PKA-ACTH signaling pathway
N00325  Mutation-inactivated RASD1 to CRHR-PKA-ACTH signaling pathway
N00326  Mutation-activated GNAS to CRHR-PKA-ACTH signaling pathway
N00403  CX3CR1-GNAI-AC-PKA signaling pathway
N00404  HCMV US28 to GNAI-AC-PKA signaling pathway
N00410  DRD1-GNAS-AC-PKA signaling pathway
N00411  HCMV UL33 to GNAS-AC-PKA signaling pathway
N00412  HCMV UL33 to GNAI-AC-PKA signaling pathway
N00782  TSH-TG signaling pathway
N00783  Mutation-inactivated TSH to TSH-TG signaling pathway
N00784  Mutation-inactivated TSHR to TSH-TG signaling pathway
N00785  Mutation-inactivated PAX8 to TSH-TG signaling pathway
N00797  Mutation-activated TSHR to TSH-TG signaling pathway
Disease
H01740  Macrothrombocytopenia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5568 (PRKACG)
   04010 MAPK signaling pathway
    5568 (PRKACG)
   04310 Wnt signaling pathway
    5568 (PRKACG)
   04340 Hedgehog signaling pathway
    5568 (PRKACG)
   04371 Apelin signaling pathway
    5568 (PRKACG)
   04020 Calcium signaling pathway
    5568 (PRKACG)
   04024 cAMP signaling pathway
    5568 (PRKACG)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    5568 (PRKACG)
  09143 Cell growth and death
   04114 Oocyte meiosis
    5568 (PRKACG)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    5568 (PRKACG)
   04540 Gap junction
    5568 (PRKACG)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    5568 (PRKACG)
   04062 Chemokine signaling pathway
    5568 (PRKACG)
  09152 Endocrine system
   04911 Insulin secretion
    5568 (PRKACG)
   04910 Insulin signaling pathway
    5568 (PRKACG)
   04922 Glucagon signaling pathway
    5568 (PRKACG)
   04923 Regulation of lipolysis in adipocytes
    5568 (PRKACG)
   04912 GnRH signaling pathway
    5568 (PRKACG)
   04913 Ovarian steroidogenesis
    5568 (PRKACG)
   04915 Estrogen signaling pathway
    5568 (PRKACG)
   04914 Progesterone-mediated oocyte maturation
    5568 (PRKACG)
   04921 Oxytocin signaling pathway
    5568 (PRKACG)
   04926 Relaxin signaling pathway
    5568 (PRKACG)
   04918 Thyroid hormone synthesis
    5568 (PRKACG)
   04919 Thyroid hormone signaling pathway
    5568 (PRKACG)
   04928 Parathyroid hormone synthesis, secretion and action
    5568 (PRKACG)
   04916 Melanogenesis
    5568 (PRKACG)
   04924 Renin secretion
    5568 (PRKACG)
   04925 Aldosterone synthesis and secretion
    5568 (PRKACG)
   04927 Cortisol synthesis and secretion
    5568 (PRKACG)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5568 (PRKACG)
   04270 Vascular smooth muscle contraction
    5568 (PRKACG)
  09154 Digestive system
   04970 Salivary secretion
    5568 (PRKACG)
   04971 Gastric acid secretion
    5568 (PRKACG)
   04976 Bile secretion
    5568 (PRKACG)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    5568 (PRKACG)
   04961 Endocrine and other factor-regulated calcium reabsorption
    5568 (PRKACG)
  09156 Nervous system
   04724 Glutamatergic synapse
    5568 (PRKACG)
   04727 GABAergic synapse
    5568 (PRKACG)
   04725 Cholinergic synapse
    5568 (PRKACG)
   04728 Dopaminergic synapse
    5568 (PRKACG)
   04726 Serotonergic synapse
    5568 (PRKACG)
   04720 Long-term potentiation
    5568 (PRKACG)
   04723 Retrograde endocannabinoid signaling
    5568 (PRKACG)
  09157 Sensory system
   04740 Olfactory transduction
    5568 (PRKACG)
   04742 Taste transduction
    5568 (PRKACG)
   04750 Inflammatory mediator regulation of TRP channels
    5568 (PRKACG)
  09149 Aging
   04211 Longevity regulating pathway
    5568 (PRKACG)
   04213 Longevity regulating pathway - multiple species
    5568 (PRKACG)
  09159 Environmental adaptation
   04713 Circadian entrainment
    5568 (PRKACG)
   04714 Thermogenesis
    5568 (PRKACG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5568 (PRKACG)
   05205 Proteoglycans in cancer
    5568 (PRKACG)
   05203 Viral carcinogenesis
    5568 (PRKACG)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    5568 (PRKACG)
   05020 Prion diseases
    5568 (PRKACG)
  09165 Substance dependence
   05030 Cocaine addiction
    5568 (PRKACG)
   05031 Amphetamine addiction
    5568 (PRKACG)
   05032 Morphine addiction
    5568 (PRKACG)
   05034 Alcoholism
    5568 (PRKACG)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    5568 (PRKACG)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    5568 (PRKACG)
  09171 Infectious disease: bacterial
   05110 Vibrio cholerae infection
    5568 (PRKACG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    5568 (PRKACG)
   05163 Human cytomegalovirus infection
    5568 (PRKACG)
   05165 Human papillomavirus infection
    5568 (PRKACG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    5568 (PRKACG)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    5568 (PRKACG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5568 (PRKACG)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    5568 (PRKACG)
   03036 Chromosome and associated proteins [BR:hsa03036]
    5568 (PRKACG)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     5568 (PRKACG)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  PKA family
   5568 (PRKACG)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     5568 (PRKACG)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    5568 (PRKACG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Haspin_kinase Kdo RIO1
Motif
Other DBs
NCBI-GeneID: 5568
NCBI-ProteinID: NP_002723
OMIM: 176893
HGNC: 9382
Ensembl: ENSG00000165059
Vega: OTTHUMG00000019974
Pharos: P22612(Tbio)
UniProt: P22612
Position
9q21.11
AA seq 351 aa AA seqDB search
MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVML
VRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLV
MEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGY
LQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFY
ADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFAT
TSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacgcccccgccaagaaggacaccgagcaggaggagagcgtgaacgagttccta
gccaaagccagaggagatttcctctacagatggggaaaccccgctcaaaacaccgccagc
tcggatcagttcgaacggctcaggacgctgggcatgggctccttcgggcgggtgatgctg
gtgaggcaccaggagaccggcggccactacgccatgaagatcctcaacaagcagaaggtg
gtgaagatgaagcaggtcgagcacatactgaacgagaagcgcatcctgcaggcgatcgac
tttccgttcctcgtcaagctccagttctcctttaaggacaactcctacctgtacctggtg
atggagtacgtgccgggtggggagatgttctcccgcctacagcgcgtcggaaggtttagc
gagccccatgcctgtttctatgccgcccaggtcgtcctggccgtccagtacctacactcg
ctcgacctcatccaccgcgacctgaagcccgagaatctcctcatcgaccagcagggctac
ctgcaggtgacggacttcggtttcgccaagcgcgtgaagggccgcacttggaccttgtgc
gggaccccagagtacctggcccccgagatcatcctgagcaaaggctacaacaaggccgtg
gactggtgggccctaggggtgctcatctatgagatggccgtgggcttcccacccttctac
gccgaccagcccatccagatctacgagaagatcgtctctgggagggtgcggtttccctcc
aaactcagctctgacctcaagcatctgctgcggagcctgctgcaggtggacctcaccaag
cgcttcggaaacctcaggaacggggttggcgacatcaagaaccacaagtggttcgccaca
accagctggatcgccatctatgagaagaaggtggaagctcccttcatcccgaagtacaca
ggccctggggatgccagtaactttgacgactacgaggaggaagagctccggatctccatc
aatgagaagtgtgccaaggagttttctgagttttag

DBGET integrated database retrieval system