KEGG   Homo sapiens (human): 55681Help
Entry
55681             CDS       T01001                                 

Gene name
SCYL2, CVAK104
Definition
(RefSeq) SCY1 like pseudokinase 2
  KO
K17541  SCY1-like protein 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    55681 (SCYL2)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    55681 (SCYL2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  SCY1 family [OT]
   55681 (SCYL2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    55681 (SCYL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr XRN_M CENP-B_N
Motif
Other DBs
NCBI-GeneID: 55681
NCBI-ProteinID: NP_001304713
OMIM: 616365
HGNC: 19286
Ensembl: ENSG00000136021
Vega: OTTHUMG00000170319
Pharos: Q6P3W7(Tbio)
UniProt: Q6P3W7
Position
12q23.1
AA seq 929 aa AA seqDB search
MESMLNKLKSTVTKVTADVTSAVMGNPVTREFDVGRHIASGGNGLAWKIFNGTKKSTKQE
VAVFVFDKKLIDKYQKFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTE
PVFASLANVLGNWENLPSPISPDIKDYKLYDVETKYGLLQVSEGLSFLHSSVKMVHGNIT
PENIILNKSGAWKIMGFDFCVSSTNPSEQEPKFPCKEWDPNLPSLCLPNPEYLAPEYILS
VSCETASDMYSLGTVMYAVFNKGKPIFEVNKQDIYKSFSRQLDQLSRLGSSSLTNIPEEV
REHVKLLLNVTPTVRPDADQMTKIPFFDDVGAVTLQYFDTLFQRDNLQKSQFFKGLPKVL
PKLPKRVIVQRILPCLTSEFVNPDMVPFVLPNVLLIAEECTKEEYVKLILPELGPVFKQQ
EPIQILLIFLQKMDLLLTKTPPDEIKNSVLPMVYRALEAPSIQIQELCLNIIPTFANLID
YPSMKNALIPRIKNACLQTSSLAVRVNSLVCLGKILEYLDKWFVLDDILPFLQQIPSKEP
AVLMGILGIYKCTFTHKKLGITKEQLAGKVLPHLIPLSIENNLNLNQFNSFISVIKEMLN
RLESEHKTKLEQLHIMQEQQKSLDIGNQMNVSEEMKVTNIGNQQIDKVFNNIGADLLTGS
ESENKEDGLQNKHKRASLTLEEKQKLAKEQEQAQKLKSQQPLKPQVHTPVATVKQTKDLT
DTLMDNMSSLTSLSVSTPKSSASSTFTSVPSMGIGMMFSTPTDNTKRNLTNGLNANMGFQ
TSGFNMPVNTNQNFYSSPSTVGVTKMTLGTPPTLPNFNALSVPPAGAKQTQQRPTDMSAL
NNLFGPQKPKVSMNQLSQQKPNQWLNQFVPPQGSPTMGSSVMGTQMNVIGQSAFGMQGNP
FFNPQNFAQPPTTMTNSSSASNDLKDLFG
NT seq 2790 nt NT seq  +upstreamnt  +downstreamnt
atggagtccatgcttaataaattgaagagtactgttacaaaagtaacagctgatgtcact
agtgctgtaatgggaaatcctgtcactagagaatttgatgttggtcgacacattgccagt
ggtggcaatgggctagcttggaagatttttaatggcacaaaaaagtcaacaaagcaggaa
gtggcagtttttgtctttgataaaaaactgattgacaagtatcaaaaatttgaaaaggat
caaatcattgattctctaaaacgaggagtccaacagttaactcggcttcgacaccctcga
cttcttactgtccagcatcctttagaagaatccagggattgcttggcattttgtacagaa
ccagtttttgccagtttagccaatgttcttggtaactgggaaaatctaccttcccctata
tctccagacattaaggattataaactttatgatgtagaaaccaaatatggtttgcttcag
gtttctgaaggattgtcattcttgcatagcagtgtgaaaatggtgcatggaaatatcact
cctgaaaatataattttgaataaaagtggagcctggaaaataatgggttttgatttttgt
gtatcatcaaccaatccttctgaacaagagcctaaatttccttgtaaagaatgggaccca
aatttaccttcattgtgtcttccaaatcctgaatatttggctcctgaatacatactttct
gtgagctgtgaaacagccagtgatatgtattctttaggaactgttatgtatgctgtattt
aataaagggaaacctatatttgaagtcaacaagcaagatatttacaagagtttcagtagg
cagttggatcagttgagtcgtttaggatctagttcacttacaaatatacctgaggaagtt
cgtgaacatgtaaagctactgttaaatgtaactccgactgtaagaccagatgcagatcaa
atgacaaagattcccttctttgatgatgttggtgcagtaacactgcaatattttgatacc
ttattccaaagagataatcttcagaaatcacagtttttcaaaggactgccaaaggttcta
ccaaaactgcccaagcgtgtcattgtgcagagaattttgccttgtttgacttcagaattt
gtaaaccctgacatggtaccttttgttttgcccaatgttctacttattgctgaggaatgc
accaaagaagaatatgtcaaattaattcttcctgaacttggccctgtgtttaagcagcag
gagccaatccagattttgttaattttcctacaaaaaatggatttgctactaaccaaaacc
cctcctgatgagataaagaacagtgttctacccatggtttacagagcactagaagctcct
tccattcagatccaggagctctgtctaaacatcattccaacctttgcaaatcttatagac
tacccatccatgaaaaacgctttgataccaagaattaaaaatgcttgtctacaaacatct
tcccttgcggttcgtgtaaattcattagtgtgcttaggaaagattttggaatacttggat
aagtggtttgtacttgatgatatcctacccttcttacaacaaattccatccaaggaacct
gcggtcctcatgggaattttaggtatttacaaatgtacttttactcataagaagttggga
atcaccaaagagcagctggccggaaaagtgttgcctcatcttattcccctgagtattgaa
aacaatcttaatcttaatcagttcaattctttcatttccgtcataaaagaaatgcttaat
agattggagtctgaacataagactaaactggagcaacttcatataatgcaagaacagcag
aaatctttggatataggaaatcaaatgaatgtttctgaggagatgaaagttacaaatatt
gggaatcagcaaattgacaaagtttttaacaacattggagcagaccttctgactggcagt
gagtccgaaaataaagaggacgggttacagaataaacataaaagagcatcacttacactt
gaagaaaaacaaaaattagcaaaagaacaagagcaggcacagaagctgaaaagccagcag
cctcttaaaccccaagtgcacacacctgttgctactgttaaacagactaaggacttgaca
gacacactgatggataatatgtcatccttgaccagcctttctgttagtacccctaaatct
tctgcttcaagtactttcacttctgttccttccatgggcattggtatgatgttttctaca
ccaactgataatacaaagagaaatttgacaaatggcctaaatgccaatatgggctttcag
acttcaggattcaacatgcccgttaatacaaaccagaacttctacagtagtccaagcaca
gttggagtgaccaagatgactctgggaacacctcccactttgccaaacttcaatgctttg
agtgttcctcctgctggtgcaaagcagacccaacaaagacccacagatatgtctgccctt
aataatctctttggccctcagaaacccaaagttagcatgaaccagttatcacaacagaaa
ccaaatcagtggcttaatcagtttgtacctcctcaaggttctccaactatgggcagttca
gtaatggggacacagatgaacgtgataggacaatctgcttttggtatgcagggtaatcct
ttctttaacccacagaactttgcacagccaccaactactatgaccaatagcagttcagct
agcaatgatttaaaagatctttttgggtga

DBGET integrated database retrieval system