KEGG   Homo sapiens (human): 55687Help
Entry
55687             CDS       T01001                                 

Gene name
TRMU, LCAL3, MTO2, MTU1, TRMT, TRMT1
Definition
(RefSeq) tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase
  KO
K21027  tRNA-5-taurinomethyluridine 2-sulfurtransferase [EC:2.8.1.14]
Organism
hsa  Homo sapiens (human)
Disease
H01367  Infantile liver failure
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hsa03016]
    55687 (TRMU)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.14  tRNA-5-taurinomethyluridine 2-sulfurtransferase
     55687 (TRMU)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic type
  tRNA modification factors
   Thiolation factors
    55687 (TRMU)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA_Me_trans ThiI NAD_synthase Asn_synthase QueC
Motif
Other DBs
NCBI-GeneID: 55687
NCBI-ProteinID: NP_060476
OMIM: 610230
HGNC: 25481
Ensembl: ENSG00000100416
Vega: OTTHUMG00000150424
Pharos: O75648(Tbio)
UniProt: O75648
Position
22q13.31
AA seq 421 aa AA seqDB search
MQALRHVVCALSGGVDSAVAALLLRRRGYQVTGVFMKNWDSLDEHGVCTADKDCEDAYRV
CQILDIPFHQVSYVKEYWNDVFSDFLNEYEKGRTPNPDIVCNKHIKFSCFFHYAVDNLGA
DAIATGHYARTSLEDEEVFEQKHVKKPEGLFRNRFEVRNAVKLLQAADSFKDQTFFLSQV
SQDALRRTIFPLGGLTKEFVKKIAAENRLHHVLQKKESMGMCFIGKRNFEHFLLQYLQPR
PGHFISIEDNKVLGTHKGWFLYTLGQRANIGGLREPWYVVEKDSVKGDVFVAPRTDHPAL
YRDLLRTSRVHWIAEEPPAALVRDKMMECHFRFRHQMALVPCVLTLNQDGTVWVTAVQAV
RALATGQFAVFYKGDECLGSGKILRLGPSAYTLQKGQRRAGMATESPSDSPEDGPGLSPL
L
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccttgcggcacgtcgtgtgcgccctgtccggcggcgtggacagcgccgtggcc
gcgctgctgctgaggcggagaggttaccaggtgacaggggtgtttatgaagaactgggac
tcactggatgaacatggggtctgtactgccgacaaagactgtgaagatgcttacagagtt
tgccagatcttagacatccctttccatcaagtgtcctacgtaaaggagtattggaatgat
gtgttcagtgactttttgaatgagtatgaaaaaggaaggactcccaatcctgacatagtt
tgcaacaagcacatcaaatttagttgcttttttcattatgctgtggataatcttggggca
gatgccattgccacaggtcactatgcaagaacttccctggaagatgaagaagtctttgag
cagaagcacgttaagaagcccgaagggcttttcagaaatcggtttgaagttagaaatgcg
gtaaaactcctccaggcagctgacagctttaaagaccagaccttctttctcagccaggtt
tcccaggatgccctgaggagaaccatcttccctctggggggattaacgaaagagtttgta
aagaaaatcgctgctgagaatagacttcatcatgtgcttcagaagaaagagagcatgggc
atgtgtttcatcgggaagaggaattttgaacatttccttcttcagtatctgcagcctcga
cctggtcactttatttccatagaagacaataaggttctgggaacacataaaggttggttc
ctgtataccttgggccagagagcaaacataggtggcctgagagagccctggtacgtggtg
gagaaggacagcgtcaagggtgacgtgtttgtggccccccggacagaccacccagccctg
tacagggacctgctgaggaccagccgcgtgcactggattgcggaggagcctcccgcagca
ctggtccgggacaagatgatggagtgccacttccgattccgccaccagatggcactagtg
ccctgtgtgctgaccctcaatcaagatggcaccgtgtgggtgacagctgtgcaggctgtg
cgtgcccttgccacaggacagtttgctgtgttctacaagggggacgagtgcctgggcagc
gggaagatcctgcggctggggccgtctgcctacacgctccagaagggccagcgcagagct
gggatggccactgagagccccagtgacagcccagaagatggtccaggcctgagtcccttg
ctctga

DBGET integrated database retrieval system