KEGG   Homo sapiens (human): 5569Help
Entry
5569              CDS       T01001                                 

Gene name
PKIA, PRKACN1
Definition
(RefSeq) cAMP-dependent protein kinase inhibitor alpha
  KO
K15985  cAMP-dependent protein kinase inhibitor alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    5569 (PKIA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PKI
Motif
Other DBs
NCBI-GeneID: 5569
NCBI-ProteinID: NP_006814
OMIM: 606059
HGNC: 9017
Ensembl: ENSG00000171033
Vega: OTTHUMG00000164618
Pharos: P61925(Tbio)
UniProt: P61925 A0A024R7Y9
Structure
PDB: 

Position
8q21.13
AA seq 76 aa AA seqDB search
MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAGLDINKTEGEEDAQRSS
TEQSGEAQGEAAKSES
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
atgactgatgtggaaactacatatgcagattttattgcttcaggaagaacaggtagaaga
aatgcaatacatgatatcctggtttcctctgcaagtggcaacagcaatgaattagccttg
aaattagcaggtcttgatatcaacaagacagaaggtgaagaagatgcacaacgaagttct
acagaacaaagtggggaagcccagggagaagcagcaaaatctgaaagctaa

DBGET integrated database retrieval system