KEGG   Homo sapiens (human): 55696Help
Entry
55696             CDS       T01001                                 

Gene name
RBM22, Cwc2, ZC3H16, fSAP47
Definition
(RefSeq) RNA binding motif protein 22
  KO
K12872  pre-mRNA-splicing factor RBM22/SLT11
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Module
hsa_M00355  Spliceosome, 35S U5-snRNP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    55696 (RBM22)
Spliceosome [BR:hsa03041]
 Complex B
  Other components
   Prp19-related factors
    55696 (RBM22)
 Complex C
    55696 (RBM22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 Torus Nup35_RRM_2 RRM_occluded zf-CCCH RRM_3 FYVE zf-CCCH_2 zf-CCCH_3
Motif
Other DBs
NCBI-GeneID: 55696
NCBI-ProteinID: NP_060517
OMIM: 612430
HGNC: 25503
Ensembl: ENSG00000086589
Vega: OTTHUMG00000163589
Pharos: Q9NW64(Tbio)
UniProt: Q9NW64
Structure
PDB: 

Position
5q33.1
AA seq 420 aa AA seqDB search
MATSLGSNTYNRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPG
VRMRFKKTEVCQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQN
MEREISNSDGTRPVGMLGKATSTSDMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECP
YRHEKPTDPDDPLADQNIKDRYYGINDPVADKLLKRASTMPRLDPPEDKTITTLYVGGLG
DTITETDLRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNV
KWGRSQAARGKEKEKDGTTDSGIKLEPVPGLPGALPPPPAAEEEASANYFNLPPSGPPAV
VNIALPPPPGIAPPPPPGFGPHMFHPMGPPPPFMRAPGPIHYPSQDPQRMGAHAGKHSSP
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggcgacctctctgggttccaacacctacaacaggcagaactgggaggatgcggacttc
cccattctgtgccagacatgtcttggagaaaacccatatatccgaatgaccaaagaaaag
tatgggaaggaatgcaaaatctgtgccaggccattcacagtgtttcgctggtgccctgga
gtccgcatgcgtttcaagaagactgaagtgtgccaaacctgcagtaaattgaagaatgtc
tgtcagacctgcctcttagacctagagtatggcctgcccatccaggttcgtgacgcagga
ttgtcttttaaagatgacatgccaaagtcagatgtcaacaaagagtactatacacagaat
atggagagagagatttctaactctgatggaacacggccagttggcatgctggggaaagcc
acatctaccagtgacatgctgctcaaactggcccggaccacaccctactacaaaaggaat
cgaccccacatttgctccttctgggtgaaaggagagtgtaagagaggagaggaatgtcca
tacagacatgagaagcctacagatccagatgacccccttgctgatcagaatattaaagac
cgttattacggaatcaatgatcctgtagctgacaagcttctaaagcgggcttcaacaatg
cctcggctggacccaccagaggataaaactatcaccacactatatgttggtggtctaggt
gataccattactgagacagatttaagaaatcatttctaccagttcggagagatccggacg
atcactgttgtgcagagacagcagtgtgctttcatccagtttgccacacggcaggctgca
gaagtggctgctgagaagtcctttaataagttgattgtaaatggccgcagactgaatgtg
aaatggggaagatcccaggcagccagaggaaaagaaaaagagaaagatggaactacagac
tctgggatcaaactagaacctgttccaggattgccaggagctcttcctcctcctcctgca
gcagaagaagaagcctctgccaactacttcaacttgcccccaagtggtcctccagctgtg
gtgaacattgctctgccaccgccccctggcattgctccacccccacccccaggttttggg
ccacacatgttccacccaatgggaccaccccctcctttcatgcgggctccaggaccaatc
cactatccttctcaggaccctcagaggatgggagctcatgctggaaaacacagcagcccc
tag

DBGET integrated database retrieval system