KEGG   Homo sapiens (human): 55699Help
Entry
55699             CDS       T01001                                 

Gene name
IARS2, CAGSSS, ILERS
Definition
(RefSeq) isoleucyl-tRNA synthetase 2, mitochondrial
  KO
K01870  isoleucyl-tRNA synthetase [EC:6.1.1.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00970  Aminoacyl-tRNA biosynthesis
Module
hsa_M00359  Aminoacyl-tRNA biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    55699 (IARS2)
Enzymes [BR:hsa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.5  isoleucine---tRNA ligase
     55699 (IARS2)
Amino acid related enzymes [BR:hsa01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   55699 (IARS2)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    55699 (IARS2)
 Prokaryotic Type
   Other AARSs
    55699 (IARS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1 Anticodon_1 tRNA-synt_1g tRNA-synt_1_2 zf-FPG_IleRS
Motif
Other DBs
NCBI-GeneID: 55699
NCBI-ProteinID: NP_060530
OMIM: 612801
HGNC: 29685
Ensembl: ENSG00000067704
Vega: OTTHUMG00000037287
Pharos: Q9NSE4(Tbio)
UniProt: Q9NSE4
Position
1q41
AA seq 1012 aa AA seqDB search
MRWGLRPRGPGAAALATARSLWGTPRLPCSPGWQGATKRLLVRSVSGASNHQPNSNSGRY
RDTVLLPQTSFPMKLLGRQQPDTELEIQQKCGFSELYSWQRERKVKTEFCLHDGPPYANG
DPHVGHALNKILKDIANRFHMMNGSKIHFVPGWDCHGLPIEIKVLSELGREAQNLSAMEI
RKKARSFAKAAIEKQKSAFIRWGIMADWNNCYYTFDGKYEAKQLRTFYQMYDKGLVYRSY
KPVFWSPSSRTALAEAELEYNPEHVSRSIYVKFPLLKPSPKLASLIDGSSPVSILVWTTQ
PWTIPANEAVCYMPESKYAVVKCSKSGDLYVLAADKVASVASTLETTFETISTLSGVDLE
NGTCSHPLIPDKASPLLPANHVTMAKGTGLVHTAPAHGMEDYGVASQHNLPMDCLVDEDG
VFTDVAGPELQNKAVLEEGTDVVIKMLQTAKNLLKEEKLVHSYPYDWRTKKPVVIRASKQ
WFINITDIKTAAKELLKKVKFIPGSALNGMVEMMDRRPYWCISRQRVWGVPIPVFHHKTK
DEYLINSQTTEHIVKLVEQHGSDIWWTLPPEQLLPKEVLSEVGGPDALEYVPGQDILDIW
FDSGTSWSYVLPGPDQRADLYLEGKDQLGGWFQSSLLTSVAARKRAPYKTVIVHGFTLGE
KGEKMSKSLGNVIHPDVVVNGGQDQSKEPPYGADVLRWWVADSNVFTEVAIGPSVLNAAR
DDISKLRNTLRFLLGNVADFNPETDSIPVNDMYVIDQYMLHLLQDLANKITELYKQYDFG
KVVRLLRTFYTRELSNFYFSIIKDRLYCEKENDPKRRSCQTALVEILDVIVRSFAPILPH
LAEEVFQHIPYIKEPKSVFRTGWISTSSIWKKPGLEEAVESACAMRDSFLGSIPGKNAAE
YKVITVIEPGLLFEIIEMLQSEETSSTSQLNELMMASESTLLAQEPREMTADVIELKGKF
LINLEGGDIREESSYKVIVMPTTKEKCPRCWKYTAESSDTLCPRCAEVVSGK
NT seq 3039 nt NT seq  +upstreamnt  +downstreamnt
atgcgttgggggctgcgccctcgcgggccgggcgcggccgccctggccactgcccgaagt
ttgtgggggacgccccgccttccctgcagcccgggatggcaaggggcgacgaagaggctt
ctggtgcggtcggtctccggggccagtaaccaccagccgaactcgaatagtggcagatac
cgggacacggtgctgctgccgcagacgagcttccccatgaagctgctgggccgccagcag
ccggacacggagctggagatccagcagaaatgtggattttcagaactttattcatggcaa
agagaaagaaaagtaaagacagaattttgccttcatgatggacctccttatgcaaacggt
gaccctcatgttggacatgctttaaataagattttgaaagacatagccaatcgattccat
atgatgaatggctccaaaatacattttgtgcccggctgggattgtcatgggttgcccatt
gaaataaaagtattatcagaacttggtagagaagctcagaatctttcagctatggaaatt
agaaagaaagctagatcatttgctaaagcagccattgagaaacagaaatcagcatttatt
cgttggggaataatggcagattggaataattgctactatacatttgatgggaagtatgaa
gccaaacagttgagaactttttaccaaatgtatgataagggcttggtttatcgatcttac
aaacctgtgttttggtctccgtcatctaggactgcattggctgaagcagaacttgaatat
aatcctgagcatgtcagtcgttcaatatatgtaaaatttcctctcttaaagccttctcca
aaattggcatctcttatagatggttcatctcctgttagtattttggtctggaccacacaa
ccttggacgattccagccaatgaagctgtttgctatatgcctgaatcaaagtatgctgtt
gtgaaatgttctaagtctggagacctctacgtactggcggcagataaagtagcatctgtt
gcttctactttggaaacaacatttgagactatttcaacactttcaggtgtagatttggaa
aatggtacttgcagtcatccattaattcctgataaagcctctcctcttttacctgcaaat
catgtgaccatggcaaaaggaacgggattggttcacacagccccagctcatggtatggaa
gactacggtgtagcgtctcagcacaacctgcccatggattgtctagtggacgaagatgga
gttttcacagatgttgcaggtcctgaacttcaaaacaaggctgtccttgaagagggaact
gatgtggttataaagatgcttcagactgcaaagaatttgttgaaagaggagaaattggtg
catagctatccgtatgactggaggaccaagaaacctgtggttattcgtgccagcaagcag
tggtttataaacatcacggatattaagactgcagccaaggaattgttaaaaaaggtgaaa
tttattcctggatcagcactgaatggcatggttgaaatgatggacaggcggccatattgg
tgtatatcaaggcaaagagtttggggtgttccaattcctgtgtttcatcataagaccaag
gatgaatacttgatcaacagccaaaccactgagcatattgttaaactagtggaacaacac
ggcagtgatatctggtggactcttccccctgaacaacttcttccaaaagaagtcttatct
gaggttggtggccctgatgccttggaatatgtgccaggtcaggatattttggacatctgg
tttgatagcggaacttcatggtcttatgttcttccaggtcctgaccaaagagcagatttg
tacttggaaggaaaagaccagctcgggggttggtttcagtcatccttattaacaagtgtg
gcagcaaggaagagagcaccttataagacagtgattgttcatggatttacccttggagaa
aagggagaaaagatgtccaagtctcttgggaatgtcattcatcctgatgttgtcgttaat
ggaggacaagatcaaagcaaagagcctccgtatggtgctgatgtccttcgctggtgggta
gctgattccaatgtcttcaccgaagttgcaattggcccatccgtgctcaatgctgccaga
gatgatattagcaagcttaggaatacacttcgctttcttttgggaaatgtggctgatttc
aacccagaaacagattccatccctgtaaacgatatgtatgtcatagaccagtacatgcta
cacttactgcaggatttggcaaacaagattaccgaattatacaaacaatatgattttgga
aaagttgttcggctgttacggacgttttataccagagagctctctaacttttatttcagt
ataatcaaagataggctctattgtgaaaaggaaaatgaccccaaacgacgctcttgtcag
actgcattagttgaaattttggatgtaatagttcgttcttttgctcccattcttcctcac
ctggctgaagaggtgttccagcacataccttatattaaagagcccaagagtgttttccgt
actgggtggattagtactagttctatctggaaaaagcccgggttggaagaagctgtggag
agtgcgtgtgcaatgcgagactcatttcttggaagcatccctggcaaaaatgcagctgag
tacaaggttatcactgtgatagaacctggactgctttttgagataatagagatgctgcag
tctgaagagacttccagcacctctcagttgaatgaattaatgatggcttctgagtcaact
ttactggctcaggaaccacgagagatgactgcagatgtaatcgagcttaaagggaaattc
ctcatcaacttagaaggtggtgatattcgtgaagagtcttcctataaagtaattgtcatg
ccgactacgaaagaaaaatgcccccgttgttggaagtatacagcggagtcttcagataca
ctgtgtcctcgatgtgcagaagttgtcagtggaaaatag

DBGET integrated database retrieval system