KEGG   Homo sapiens (human): 55706Help
Entry
55706             CDS       T01001                                 

Gene name
NDC1, NET3, TMEM48
Definition
(RefSeq) NDC1 transmembrane nucleoporin
  KO
K14315  nucleoporin NDC1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
Module
hsa_M00427  Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    55706 (NDC1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     55706 (NDC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ndc1_Nup
Motif
Other DBs
NCBI-GeneID: 55706
NCBI-ProteinID: NP_060557
OMIM: 610115
HGNC: 25525
Ensembl: ENSG00000058804
Vega: OTTHUMG00000008073
Pharos: Q9BTX1(Tbio)
UniProt: Q9BTX1
Position
1p32.3
AA seq 674 aa AA seqDB search
MATAVSRPCAGRSRDILWRVLGWRIVASIVWSVLFLPICTTVFIIFSRIDLFHPIQWLSD
SFSDLYSSYVIFYFLLLSVVIIIISIFNVEFYAVVPSIPCSRLALIGKIIHPQQLMHSFI
HAAMGMVMAWCAAVITQGQYSFLVVPCTGTNSFGSPAAQTCLNEYHLFFLLTGAFMGYSY
SLLYFVNNMNYLPFPIIQQYKFLRFRRSLLLLVKHSCVESLFLVRNFCILYYFLGYIPKA
WISTAMNLHIDEQVHRPLDTVSGLLNLSLLYHVWLCGVFLLTTWYVSWILFKIYATEAHV
FPVQPPFAEGSDECLPKVLNSNPPPIIKYLALQDLMLLSQYSPSRRQEVFSLSQPGGHPH
NWTAISRECLNLLNGMTQKLILYQEAAATNGRVSSSYPVEPKKLNSPEETAFQTPKSSQM
PRPSVPPLVKTSLFSSKLSTPDVVSPFGTPFGSSVMNRMAGIFDVNTCYGSPQSPQLIRR
GPRLWTSASDQQMTEFSNPSPSTSISAEGKTMRQPSVIYSWIQNKREQIKNFLSKRVLIM
YFFSKHPEASIQAVFSDAQMHIWALEGLSHLVAASFTEDRFGVVQTTLPAILNTLLTLQE
AVDKYFKLPHASSKPPRISGSLVDTSYKTLRFAFRASLKTAIYRITTTFGEHLNAVQASA
EHQKRLQQFLEFKE
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atggccacggccgtgagccggccctgcgccggcaggtcgcgggacatactgtggcgcgtt
ttgggctggaggatagttgcaagtattgtttggtcagtgctatttctacccatctgcacc
acagtatttataattttcagcaggattgatttgtttcatcctatacagtggctgtctgat
tctttcagtgacctgtatagttcctatgtaatcttttacttcctgctgctgtcagtggta
ataataataataagtattttcaatgtggagttctatgcagttgtgccttctattccttgc
tccagactagctctgatagggaagatcattcatcctcagcaactcatgcactcatttatt
catgctgcaatgggaatggtgatggcctggtgtgctgcagtgataacccagggccagtac
agctttcttgtggttccctgcactggtactaacagctttggtagccctgctgcgcaaacc
tgcttaaatgaatatcatctttttttcctactgactggagcatttatgggctatagctat
agcctcctgtattttgttaacaacatgaactatcttccatttcccatcatacagcaatac
aagttcttgcgttttaggagatctctgctcttattagttaaacacagttgtgtggaatca
ctgttcctggttagaaatttctgcattttatattattttcttggctatattcccaaagct
tggattagcactgctatgaaccttcacatagatgagcaggttcataggccacttgacaca
gtgagtggcctcttaaatctctcgttactctaccatgtctggctgtgtggtgtctttctc
ctgacgacttggtatgtctcatggatactcttcaaaatctatgccacagaggctcatgtg
tttcctgttcaaccaccatttgcagaagggtcagatgagtgccttccaaaagtgttaaat
agcaatcctccccccatcataaagtatttagccttgcaggacctgatgttgctttctcaa
tattctccttcacgaagacaagaagttttcagcctcagccaaccaggtggacatccccac
aattggacagccatttcaagggagtgtttgaatcttttaaatggtatgactcagaaactg
attctctatcaagaagctgctgctacgaatgggagagtgtcttcatcttacccagtggaa
cctaagaaattaaattctccagaagaaactgcttttcagacaccaaaatctagccagatg
cctcggccttcagtgccaccattagttaaaacatcactgttttcttcaaaattatctaca
cctgatgttgtgagcccatttgggaccccatttggctctagtgtaatgaatcggatggct
ggaatttttgatgtaaacacctgctatgggtcaccgcaaagtcctcagctaataagaagg
gggccaagattgtggacatcagcttctgatcagcaaatgactgaattttctaatccttct
ccatctacctctattagtgctgagggtaagacaatgagacaacccagtgtgatttattca
tggattcagaataaacgtgaacagattaagaatttcttgtcaaaacgggtgctgataatg
tattttttcagtaagcacccagaggcctccattcaggctgttttttcagatgcccaaatg
catatttgggcattagaaggtctgtcgcacttagtagcagcatcatttacagaggataga
tttggagttgtccagacgacactaccagctatccttaatactttgttgacactgcaagag
gcagtcgacaagtactttaagcttcctcatgcttccagtaaaccaccccggatttcagga
agccttgtggacacttcatataaaacattaagatttgcattcagagcatcactgaaaact
gccatctatcgaataactactacatttggtgaacatctgaatgctgtgcaagcatctgca
gaacatcagaaaagacttcaacagttcttggagttcaaagaatag

DBGET integrated database retrieval system