KEGG   Homo sapiens (human): 55707Help
Entry
55707             CDS       T01001                                 

Gene name
NECAP2
Definition
(RefSeq) NECAP endocytosis associated 2
  KO
K20069  adaptin ear-binding coat-associated protein 1/2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    55707 (NECAP2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    55707 (NECAP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF1681
Motif
Other DBs
NCBI-GeneID: 55707
NCBI-ProteinID: NP_060560
OMIM: 611624
HGNC: 25528
Ensembl: ENSG00000157191
Vega: OTTHUMG00000002313
Pharos: Q9NVZ3(Tdark)
UniProt: Q9NVZ3 A0A024QZ81
Position
1p36.13
AA seq 263 aa AA seqDB search
MEESGYESVLCVKPDVHVYRIPPRATNRGYRAAEWQLDQPSWSGRLRITAKGQMAYIKLE
DRTSGELFAQAPVDQFPGTAVESVTDSSRYFVIRIEDGNGRRAFIGIGFGDRGDAFDFNV
ALQDHFKWVKQQCEFAKQAQNPDQGPKLDLGFKEGQTIKLNIANMKKKEGAAGNPRVRPA
STGGLSLLPPPPGGKTSTLIPPPGEQLAVGGSLVQPAVAPSSGGAPVPWPQPNPATADIW
GDFTKSTGSTSSQTQPGTGWVQF
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggaggagagcgggtacgagtcggtgctctgtgtcaagcctgacgtccacgtctaccgc
atccctccgcgggctaccaaccgtggctacagggctgcggagtggcagctggaccagcca
tcatggagtggccggctgaggatcactgcaaagggacagatggcctacatcaagctggag
gacaggacgtcaggggagctctttgctcaggccccggtggatcagtttcctggcacagct
gtggagagtgtgacggattccagcaggtacttcgtgatccgcatcgaagatggaaatggg
cgacgggcgtttattggaattggcttcggggaccgaggtgatgcctttgacttcaatgtt
gcattgcaggaccatttcaagtgggtgaaacagcagtgtgaatttgcaaaacaagcccag
aacccagaccaaggccctaaactggacctgggcttcaaggagggccagaccatcaagctc
aacatcgcaaacatgaagaagaaggaaggagcagctgggaatccccgagtccggcctgcc
agcacaggagggctgagcctgcttccccctcccccaggggggaaaacctccaccctgatc
cctccccctggggagcagttggctgtggggggatccctcgtccagccagcagttgctccc
agttcaggaggtgctcctgtaccctggccacagcccaatcctgccactgctgacatctgg
ggagactttaccaaatctacaggatcaacttccagccagacccagccaggcacaggctgg
gtccagttctga

DBGET integrated database retrieval system