KEGG   Homo sapiens (human): 5571Help
Entry
5571              CDS       T01001                                 

Gene name
PRKAG1, AMPKG
Definition
(RefSeq) protein kinase AMP-activated non-catalytic subunit gamma 1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04371  Apelin signaling pathway
hsa04530  Tight junction
hsa04710  Circadian rhythm
hsa04714  Thermogenesis
hsa04910  Insulin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    5571 (PRKAG1)
   04068 FoxO signaling pathway
    5571 (PRKAG1)
   04152 AMPK signaling pathway
    5571 (PRKAG1)
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    5571 (PRKAG1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    5571 (PRKAG1)
   04922 Glucagon signaling pathway
    5571 (PRKAG1)
   04920 Adipocytokine signaling pathway
    5571 (PRKAG1)
   04921 Oxytocin signaling pathway
    5571 (PRKAG1)
  Aging
   04211 Longevity regulating pathway - mammal
    5571 (PRKAG1)
   04213 Longevity regulating pathway - multiple species
    5571 (PRKAG1)
  Environmental adaptation
   04710 Circadian rhythm
    5571 (PRKAG1)
   04714 Thermogenesis
    5571 (PRKAG1)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    5571 (PRKAG1)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    5571 (PRKAG1)
   04931 Insulin resistance
    5571 (PRKAG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CBS Cbl_N3 DUF2497
Motif
Other DBs
NCBI-GeneID: 5571
NCBI-ProteinID: NP_002724
OMIM: 602742
HGNC: 9385
Ensembl: ENSG00000181929
Vega: OTTHUMG00000170406
Pharos: P54619(Tbio)
UniProt: P54619 A0A024R125
Structure
PDB: 

Position
12q13.12
AA seq 331 aa AA seqDB search
METVISSDSSPAVENEHPQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKA
FFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREV
YLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFI
TEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDI
YSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRL
VVVDENDVVKGIVSLSDILQALVLTGGEKKP
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggagacggtcatttcttcagatagctccccagctgtggaaaatgagcatcctcaagag
accccagaatccaacaatagcgtgtatacttccttcatgaagtctcatcgctgctatgac
ctgattcccacaagctccaaattggttgtatttgatacgtccctgcaggtgaagaaagct
ttttttgctttggtgactaacggtgtacgagctgcccctttatgggatagtaagaagcaa
agttttgtgggcatgctgaccatcactgatttcatcaatatcctgcaccgctactataaa
tcagccttggtacagatctatgagctagaagaacacaagatagaaacttggagagaggtg
tatctccaggactcctttaaaccgcttgtctgcatttctcctaatgccagcttgtttgat
gctgtctcttcattaattcggaacaagatccacaggctgccagttattgacccagaatca
ggcaatactttgtacatcctcacccacaagcgcattctgaagttcctcaaattgtttatc
actgagttccccaagccagagttcatgtccaagtctctggaagagctacagattggcacc
tatgccaatattgctatggttcgcactaccacccccgtctatgtggctctggggattttt
gtacagcatcgagtctcagccctgccagtggtggatgagaaggggcgtgtggtggacatc
tactccaagtttgatgttatcaatctggcagcagaaaagacctacaacaacctagatgta
tctgtgactaaagccttgcaacatcgatcacattactttgagggtgttctcaagtgctac
ctgcatgagactctggagaccatcatcaacaggctagtggaagcagaggttcaccgactt
gtagtggtggatgaaaatgatgtggtcaagggaattgtatcactgtctgacatcctgcag
gccctggtgctcacaggtggagagaagaagccctga

DBGET integrated database retrieval system