KEGG   Homo sapiens (human): 55731
Entry
55731             CDS       T01001                                 
Symbol
FAM222B, C17orf63
Name
(RefSeq) family with sequence similarity 222 member B
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: FAM222A
Other DBs
NCBI-GeneID: 55731
NCBI-ProteinID: NP_001070966
HGNC: 25563
Ensembl: ENSG00000173065
Pharos: Q8WU58(Tdark)
UniProt: Q8WU58 A0A024QZ60 B3KQ88
Position
17:complement(28755980..28855004)
AA seq 562 aa
MLACLPGPGDLSFQLLSHTQMNTGLQKWDTTQKMRTAHYPTPAELDAYAKKVANNPLTIK
IFPNSVKVPQRKHVRRTVNGLDTSAQRYSPYPTQAATKAGLLAIVKVPAKSILKDFDGTR
ARLLPEAIMNPPVAPYATVAPSTLAHPQAQALARQQALQHAQTLAHAPPQTLQHPQGIPP
PQALSHPQSLQQPQGLGHPQPMAQTQGLVHPQALAHQGLQHPHNPLLHGGRKMPDSDAPP
NVTVSTSTIPLSMAATLQHSQPPDLSSIVHQINQFCQTRAGISTTSVCEGQIANPSPISR
SLLINASTRVSTHSVPTPMPSCVVNPMEHTHAATAALPAAGPVNLPTGISRVPTGYPSDL
KPVTWNQHQLAHLQQMCSEASGTPAPGLTGKHAAGRELAGPGFVGKAPAYPQELCLAQSF
HLKPPLEKPTPSPPVNGMAAPLAYPNGHYFQPLWNNILPTPNSDSSGSQDLAMPFHGGQP
TGAPLDCAAAPGAHYRAGTGGGPVASQNSLMQTVDYLSGDFQQACFREQSLAMLSKAHRA
PGNRAPDPTESRSLHIQHPGYR
NT seq 1689 nt   +upstreamnt  +downstreamnt
atgctagcctgtctaccagggccaggtgacctgtcctttcagcttctttctcacacgcag
atgaacactggacttcagaaatgggacactacacagaaaatgagaactgctcactatcct
accccagccgaattggatgcgtatgctaagaaggtcgcaaacaacccactgactataaaa
atcttccccaacagtgtgaaggttccccagcggaaacacgttcgtcgtactgtgaacggc
ctcgacacatcagcccagcgctacagcccctacccgacacaggctgccaccaaggcaggc
ctgcttgccattgtcaaagtgccagccaaaagcatactcaaggactttgacggcacccga
gcccggttgctccctgaggccatcatgaaccccccagtggcaccctatgctactgtggca
cccagcactttagcccacccccaggcccaggctctggcccgccagcaggccctgcagcat
gcacagaccctggcccatgcccctccccagacgctgcagcaccctcagggtatcccgcca
ccccaggcactgtcccaccctcagagcctccagcagcctcagggcctgggccaccctcag
cccatggcccaaacccagggcttggtccaccctcaggccctggctcaccagggtctccag
cacccccacaatcccttgctgcatggaggccggaagatgccagactcagatgcccccccg
aatgtgaccgtgtctacctcaactatccccctttcaatggcggccactctgcagcacagc
cagcctccggacctgagtagcatcgtgcaccagatcaaccagttttgccagacgagggca
ggcatcagcactacctcagtgtgtgagggccagatcgccaaccccagccccattagtcgc
agtctgctcatcaatgcaagcacccgggtgtcgacccacagcgtccccacaccaatgcct
tcatgtgtggtcaatcccatggagcacacccacgcggccaccgccgcgttgcctgctgca
ggtcctgtcaacctgcccacaggcatctctcgcgtccccactggctaccctagcgacctc
aagccagtcacctggaaccagcaccagctggcccacctacagcagatgtgcagcgaggct
agtgggacgccagcccctggcctgacaggcaagcatgcggcaggacgcgagttggcaggg
cctggctttgtgggcaaggcccctgcctacccgcaggaactctgcctggcgcagtccttc
catctgaagccacccctggaaaagccgaccccatccccaccagtcaacggcatggcagcc
ccattggcctaccccaatggtcactacttccaacccctgtggaacaacattctgcccact
cccaatagcgacagctcggggtctcaggaccttgccatgccgttccacggtgggcagccc
acaggtgcacccctcgactgtgcggcagctcccggggcccactaccgagcagggaccggg
ggcggtccagtggcaagccagaacagcttgatgcaaacagtggattacctaagtggggat
ttccaacaggcctgcttccgagaacagagcctggccatgctgagcaaggcccaccgagcc
cctggcaaccgagcccccgatcccacagagagtcgaagtcttcatattcagcacccaggg
tatagatag

DBGET integrated database retrieval system