KEGG   Homo sapiens (human): 55738
Entry
55738             CDS       T01001                                 

Gene name
ARFGAP1, ARF1GAP, HRIHFB2281
Definition
(RefSeq) ADP ribosylation factor GTPase activating protein 1
  KO
K12492  ADP-ribosylation factor GTPase-activating protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    55738 (ARFGAP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    55738 (ARFGAP1)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    55738 (ARFGAP1)
SSDB
Motif
Pfam: ArfGap zf-piccolo
Other DBs
NCBI-GeneID: 55738
NCBI-ProteinID: NP_060679
OMIM: 608377
HGNC: 15852
Ensembl: ENSG00000101199
Vega: OTTHUMG00000032965
Pharos: Q8N6T3(Tbio)
UniProt: Q8N6T3 Q53F62
Structure
PDB: 
3DWD

Position
20q13.33
AA seq 406 aa
MASPRTRKVLKEVRVQDENNVCFECGAFNPQWVSVTYGIWICLECSGRHRGLGVHLSFVR
SVTMDKWKDIELEKMKAGGNAKFREFLESQEDYDPCWSLQEKYNSRAAALFRDKVVALAE
GREWSLESSPAQNWTPPQPRTLPSMVHRVSGQPQSVTASSDKAFEDWLNDDLGSYQGAQG
NRYVGFGNTPPPQKKEDDFLNNAMSSLYSGWSSFTTGASRFASAAKEGATKFGSQASQKA
SELGHSLNENVLKPAQEKVKEGKIFDDVSSGVSQLASKVQGVGSKGWRDVTTFFSGKAEG
PLDSPSEGHSYQNSGLDHFQNSNIDQSFWETFGSAEPTKTRKSPSSDSWTCADTSTERRS
SDSWEVWGSASTNRNSNSDGGEGGEGTKKAVPPAVPTDDGWDNQNW
NT seq 1221 nt   +upstreamnt  +downstreamnt
atggccagcccaagaaccaggaaggttcttaaagaagtcagggtgcaggatgagaacaac
gtttgttttgagtgtggcgcgttcaatcctcagtgggtcagtgtgacctacggcatctgg
atctgcctggagtgctcggggagacaccgcgggcttggggttcacctcagctttgtgcgc
tctgttactatggacaagtggaaggacattgagcttgagaagatgaaagctggtgggaat
gctaagttccgagagttcctggagtctcaggaggattacgatccttgctggtccttgcag
gagaagtacaacagcagagccgcggccctctttagggataaggtggtcgctctggccgaa
ggcagagagtggtctctggagtcatcacctgcccagaactggaccccacctcagcccagg
acgctgccgtccatggtgcaccgagtctctggccagccgcagagtgtgaccgcctcctcg
gacaaggcttttgaagactggctgaatgatgacctcggctcctatcaaggggcccagggg
aatcgctacgtggggtttgggaacacgccaccgcctcagaagaaagaagatgacttcctc
aacaacgccatgtcctccctgtactcgggctggagcagcttcaccactggagccagccgg
tttgcctcggcagccaaggagggcgctacaaagtttggatcccaagcgagtcagaaggcg
tccgagctgggccacagcctgaacgagaacgtcctcaagcctgcgcaggagaaggtgaag
gagggaaagatttttgatgatgtctccagtggggtctctcagttggcgtccaaggtccag
ggagtcggtagtaagggatggcgggacgtcaccacctttttttcggggaaagcagagggc
cccttggacagcccctcggagggccacagttatcagaacagcggtctggaccacttccaa
aacagcaacatagaccagagcttctgggagacctttggaagtgctgagcccaccaagacc
cgcaagtccccgagcagcgacagctggacgtgcgcggacacctccaccgagaggaggagc
tcggacagctgggaggtgtggggctcggcctccaccaacaggaacagcaacagcgacggc
ggggagggcggggagggcaccaagaaggcagtgccgccggccgtgcccactgatgatggc
tgggacaaccagaactggtag

DBGET integrated database retrieval system