KEGG   Homo sapiens (human): 55740Help
Entry
55740             CDS       T01001                                 

Gene name
ENAH, ENA, MENA, NDPP1
Definition
(RefSeq) ENAH, actin regulator
  KO
K05746  enabled
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
hsa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    55740 (ENAH)
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    55740 (ENAH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WH1 VASP_tetra
Motif
Other DBs
NCBI-GeneID: 55740
NCBI-ProteinID: NP_001008493
OMIM: 609061
HGNC: 18271
Ensembl: ENSG00000154380
Vega: OTTHUMG00000037742
Pharos: Q8N8S7(Tbio)
UniProt: Q8N8S7
Structure
PDB: 

Position
1q42.12
AA seq 591 aa AA seqDB search
MSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVI
NCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFASAMMHALEVLNSQETGPTL
PRQNSQLPAQVQNGPSQEELEIQRRQLQEQQRQKELERERLERERMERERLERERLERER
LERERLEQEQLERERQERERQERLERQERLERQERLERQERLDRERQERQERERLERLER
ERQERERQEQLEREQLEWERERRISSAAAPASVETPLNSVLGDSSASEPGLQAASQPAET
PSQQGIVLGPLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQV
PPPPPPPPAPPLPASGFFLASMSEDNRPLTGLAAAIAGAKLRKVSRMEDTSFPSGGNAIG
VNSASSKTDTGRGNGPLPLGGSGLMEEMSALLARRRRIAEKGSTIETEQKEDKGEDSEPV
TSKASSTSTPEPTRKPWERTNTMNGSKSPVISRRDSPRKNQIVFDNRSYDSLHRPKSTPL
SQPSANGVQTEGLDYDRLKQDILDEMRKELTKLKEELIDAIRQELSKSNTA
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacagagtatctgtcaggcaagagctgctgtgatggtttatgatgatgccaat
aagaagtgggtgccagctggtggctcaactggattcagcagagttcatatctatcaccat
acaggcaacaacacattcagagtggtgggcaggaagattcaggaccatcaggtcgtgata
aactgtgccattcctaaagggttgaagtacaatcaagctacacagaccttccaccagtgg
cgagatgctagacaggtgtatggtctcaactttggcagcaaagaggatgccaatgtcttc
gcaagtgccatgatgcatgccttagaagtgttaaattcacaggaaacagggccaacattg
cctagacaaaactcacaactacctgctcaagttcaaaatggcccatcccaagaagaattg
gaaattcaaagaagacaactacaagaacagcaacggcaaaaggagctggagcgggaaagg
ctggagcgagaaagaatggaaagagaaaggttggagagagagaggttagaaagggaaagg
ctggagagggagcgactggaacaagaacagctggagagagagagacaagaacgggaacgg
caggaacgcctggagcggcaggaacgcctggagcggcaggaacgcctggagcggcaggaa
cgcctggatcgggagaggcaagaaagacaagaacgagagaggctggagagactggaacgg
gagaggcaagaaagggagcgacaagagcagttagaaagggaacagctggaatgggagaga
gagcgcagaatatcaagtgctgctgcccctgcctctgttgagactcctctaaactctgtg
ctgggagactcttctgcttctgagccaggcttgcaggcagcctctcagccggccgagact
ccatcccaacagggcattgtcttgggaccacttgcacctccacctcctccaccactccca
ccagggcctgcacaggcttcagtagccctccctcctcccccagggccccctccacctcct
ccactcccatccaccgggcctccaccgccccctcctccccctcctctccctaatcaagta
ccccctcctcctccaccacctcctgccccacccctccctgcatctggattctttttggca
tccatgtcagaagacaatcgccctttaactggacttgcagctgcaattgccggagcaaaa
cttaggaaagtgtcacggatggaggatacctctttcccaagtggagggaatgctattggt
gtgaactccgcctcatctaaaacagatacaggccgtggaaatggaccccttcctttaggg
ggtagtggtttaatggaagaaatgagtgccctgctggccaggaggagaagaattgctgaa
aagggatcaacaatagaaacagaacaaaaagaggacaaaggtgaagattcagagcctgta
acttctaaggcctcttcaacaagtacacctgaaccaacaagaaaaccttgggaaagaaca
aatacaatgaatggcagcaagtcacctgttatctccagacgggattctccaaggaaaaat
cagattgtttttgacaacaggtcctatgattcattacacagaccaaaatccacaccctta
tcacagcccagtgccaatggagtccagacggaaggacttgactatgacaggctgaagcag
gacattttagatgaaatgagaaaagaattaacaaagctaaaagaagagctcattgatgca
atcaggcaggaactgagcaagtcaaatactgcatag

DBGET integrated database retrieval system