KEGG   Homo sapiens (human): 55741
Entry
55741             CDS       T01001                                 

Symbol
EDEM2, C20orf31, C20orf49, bA4204.1
Name
(RefSeq) ER degradation enhancing alpha-mannosidase like protein 2
  KO
K10085  ER degradation enhancer, mannosidase alpha-like 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    55741 (EDEM2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:hsa04091]
    55741 (EDEM2)
Lectins [BR:hsa04091]
 M-type lectins
  55741 (EDEM2)
SSDB
Motif
Pfam: Glyco_hydro_47
Other DBs
NCBI-GeneID: 55741
NCBI-ProteinID: NP_060687
OMIM: 610302
HGNC: 15877
Ensembl: ENSG00000088298
Vega: OTTHUMG00000032322
Pharos: Q9BV94(Tbio)
UniProt: Q9BV94
Position
20q11.22
AA seq 578 aa
MPFRLLIPLGLLCALLPQHHGAPGPDGSAPDPAHYRERVKAMFYHAYDSYLENAFPFDEL
RPLTCDGHDTWGSFSLTLIDALDTLLILGNVSEFQRVVEVLQDSVDFDIDVNASVFETNI
RVVGGLLSAHLLSKKAGVEVEAGWPCSGPLLRMAEEAARKLLPAFQTPTGMPYGTVNLLH
GVNPGETPVTCTAGIGTFIVEFATLSSLTGDPVFEDVARVALMRLWESRSDIGLVGNHID
VLTGKWVAQDAGIGAGVDSYFEYLVKGAILLQDKKLMAMFLEYNKAIRNYTRFDDWYLWV
QMYKGTVSMPVFQSLEAYWPGLQSLIGDIDNAMRTFLNYYTVWKQFGGLPEFYNIPQGYT
VEKREGYPLRPELIESAMYLYRATGDPTLLELGRDAVESIEKISKVECGFATIKDLRDHK
LDNRMESFFLAETVKYLYLLFDPTNFIHNNGSTFDAVITPYGECILGAGGYIFNTEAHPI
DPAALHCCQRLKEEQWEVEDLMREFYSLKRSRSKFQKNTVSSGPWEPPARPGTLFSPENH
DQARERKPAKQKVPLLSCPSQPFTSKLALLGQVFLDSS
NT seq 1737 nt   +upstreamnt  +downstreamnt
atgcctttccggctgctcatcccgctcggcctcctgtgcgcgctgctgcctcagcaccat
ggtgcgccaggtcccgacggctccgcgccagatcccgcccactacagggagcgagtcaag
gccatgttctaccacgcctacgacagctacctggagaatgcctttcccttcgatgagctg
cgacctctcacctgtgacgggcacgacacctggggcagtttttctctgactctaattgat
gcactggacaccttgctgattttggggaatgtctcagaattccaaagagtggttgaagtg
ctccaggacagcgtggactttgatattgatgtgaacgcctctgtgtttgaaacaaacatt
cgagtggtaggaggactcctgtctgctcatctgctctccaagaaggctggggtggaagta
gaggctggatggccctgttccgggcctctcctgagaatggctgaggaggcggcccgaaaa
ctcctcccagcctttcagacccccactggcatgccatatggaacagtgaacttacttcat
ggcgtgaacccaggagagacccctgtcacctgtacggcagggattgggaccttcattgtt
gaatttgccaccctgagcagcctcactggtgacccggtgttcgaagatgtggccagagtg
gctttgatgcgcctctgggagagccggtcagatatcgggctggtcggcaaccacattgat
gtgctcactggcaagtgggtggcccaggacgcaggcatcggggctggcgtggactcctac
tttgagtacttggtgaaaggagccatcctgcttcaggataagaagctcatggccatgttc
ctagagtataacaaagccatccggaactacacccgcttcgatgactggtacctgtgggtt
cagatgtacaaggggactgtgtccatgccagtcttccagtccttggaggcctactggcct
ggtcttcagagcctcattggagacattgacaatgccatgaggaccttcctcaactactac
actgtatggaagcagtttggggggctcccggaattctacaacattcctcagggatacaca
gtggagaagcgagagggctacccacttcggccagaacttattgaaagcgcaatgtacctc
taccgtgccacgggggatcccaccctcctagaactcggaagagatgctgtggaatccatt
gaaaaaatcagcaaggtggagtgcggatttgcaacaatcaaagatctgcgagaccacaag
ctggacaaccgcatggagtcgttcttcctggccgagactgtgaaatacctctacctcctg
tttgacccaaccaacttcatccacaacaatgggtccaccttcgacgcggtgatcaccccc
tatggggagtgcatcctgggggctggggggtacatcttcaacacagaagctcaccccatc
gaccctgccgccctgcactgctgccagaggctgaaggaagagcagtgggaggtggaggac
ttgatgagggaattctactctctcaaacggagcaggtcgaaatttcagaaaaacactgtt
agttcggggccatgggaacctccagcaaggccaggaacactcttctcaccagaaaaccat
gaccaggcaagggagaggaagcctgccaaacagaaggtcccacttctcagctgccccagt
cagcccttcacctccaagttggcattactgggacaggttttcctagactcctcataa

KEGG   Homo sapiens (human): 80267
Entry
80267             CDS       T01001                                 

Symbol
EDEM3, C1orf22, CDG2V
Name
(RefSeq) ER degradation enhancing alpha-mannosidase like protein 3
  KO
K10086  ER degradation enhancer, mannosidase alpha-like 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    80267 (EDEM3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:hsa04091]
    80267 (EDEM3)
Lectins [BR:hsa04091]
 M-type lectins
  80267 (EDEM3)
SSDB
Motif
Pfam: Glyco_hydro_47 PA Glyco_hydro_127
Other DBs
NCBI-GeneID: 80267
NCBI-ProteinID: NP_079467
OMIM: 610214
HGNC: 16787
Ensembl: ENSG00000116406
Vega: OTTHUMG00000035387
Pharos: Q9BZQ6(Tbio)
UniProt: Q9BZQ6
Position
1q25.3
AA seq 932 aa
MSEAGGRGCGSPVPQRARWRLVAATAAFCLVSATSVWTAGAEPMSREEKQKLGNQVLEMF
DHAYGNYMEHAYPADELMPLTCRGRVRGQEPSRGDVDDALGKFSLTLIDSLDTLVVLNKT
KEFEDAVRKVLRDVNLDNDVVVSVFETNIRVLGGLLGGHSLAIMLKEKGEYMQWYNDELL
QMAKQLGYKLLPAFNTTSGLPYPRINLKFGIRKPEARTGTETDTCTACAGTLILEFAALS
RFTGATIFEEYARKALDFLWEKRQRSSNLVGVTINIHTGDWVRKDSGVGAGIDSYYEYLL
KAYVLLGDDSFLERFNTHYDAIMRYISQPPLLLDVHIHKPMLNARTWMDALLAFFPGLQV
LKGDIRPAIETHEMLYQVIKKHNFLPEAFTTDFRVHWAQHPLRPEFAESTYFLYKATGDP
YYLEVGKTLIENLNKYARVPCGFAAMKDVRTGSHEDRMDSFFLAEMFKYLYLLFADKEDI
IFDIEDYIFTTEAHLLPLWLSTTNQSISKKNTTSEYTELDDSNFDWTCPNTQILFPNDPL
YAQSIREPLKNVVDKSCPRGIIRVEESFRSGAKPPLRARDFMATNPEHLEILKKMGVSLI
HLKDGRVQLVQHAIQAASSIDAEDGLRFMQEMIELSSQQQKEQQLPPRAVQIVSHPFFGR
VVLTAGPAQFGLDLSKHKETRGFVASSKPSNGCSELTNPEAVMGKIALIQRGQCMFAEKA
RNIQNAGAIGGIVIDDNEGSSSDTAPLFQMAGDGKDTDDIKIPMLFLFSKEGSIILDAIR
EYEEVEVLLSDKAKDRDPEMENEEQPSSENDSQNQSGEQISSSSQEVDLVDQESSEENSL
NSHPESLSLADMDNAASISPSEQTSNPTENHETTNLNGECTDLDNQLQEQSETEEDSNPN
VSWGKKVQPIDSILADWNEDIEAFEMMEKDEL
NT seq 2799 nt   +upstreamnt  +downstreamnt
atgagcgaagccggcggccggggctgtgggtccccggttccccagcgagcgcgatggaga
ctagtggcggcgacggccgcgttctgcctggtgtcggccacctccgtgtggacggcgggg
gccgagcccatgagtagggaggagaaacagaagcttgggaatcaagtactggaaatgttt
gatcatgcttatggtaactatatggaacatgcttaccctgctgatgaactcatgccttta
acctgtagaggtcgagttagaggccaagagccaagtcgcggtgacgttgatgatgccttg
ggaaaattttctctgacactgattgattctttggacactcttgtggttttaaataaaact
aaagaatttgaagatgcagtgagaaaagttttaagagatgttaatttagataacgatgta
gtcgtatcagtctttgaaacaaacatcagagttcttgggggtcttttgggtgggcactcc
ctggcaatcatgctgaaagaaaaaggtgaatatatgcagtggtacaatgatgaacttctc
caaatggcaaagcagttaggttacaaacttttaccggctttcaacactaccagtggcctt
ccttatccaagaattaatttaaagtttggcatcagaaaaccagaagctcggacaggaact
gagacagatacctgtacagcttgtgcaggtaccttgatccttgaatttgctgctttaagt
cgattcacaggagcaacaatatttgaggaatatgccagaaaagctcttgattttctctgg
gaaaaaagacagcgaagtagtaatttagtgggcgtgactataaatattcatactggagat
tgggtacgaaaagatagtggagttggagcagggattgattcatattatgaatatctgttg
aaagcctatgtcttgcttggagatgacagttttctggaaagatttaacacacactatgat
gccataatgaggtatattagccagccacctcttctacttgatgtgcatatccacaaacca
atgctgaatgctcggacttggatggatgctttgcttgccttcttcccaggcttgcaggtg
ttaaagggggatattagacctgctattgaaactcatgaaatgttatatcaggtgattaaa
aaacacaattttctaccagaggcatttaccacagatttcagagtacactgggctcaacat
cctttaaggccagaatttgcagaaagtacctacttcttatataaagctacaggagatcct
tactaccttgaagtagggaagacacttattgaaaatttaaataaatatgctagagtgcct
tgcggatttgctgccatgaaggatgttcgtactggaagtcatgaggacagaatggattct
ttcttcttggctgaaatgtttaaatatctttacctgttatttgctgataaagaagacatt
atttttgacatagaagattacatctttacaacagaagctcatctgttacctctttggctc
tctactacaaatcaaagcatctctaaaaagaacacaacctcggaatatacagaactggat
gacagtaacttcgattggacttgtccaaatactcagatcctctttcctaatgacccattg
tatgctcaaagtattcgtgagcccttgaaaaatgtggtggataagagctgtcctagaggc
atcatcagagtagaggagagtttcaggagtggagctaaaccccctctgagagccagagat
ttcatggccactaaccctgagcatttagaaatcctgaagaagatgggggtgagtttgatt
cacctcaaagatgggagagtccagttggtccaacatgcaatccaagctgctagttcaatc
gacgctgaagatgggttgaggttcatgcaggagatgattgaattgtcaagtcagcaacaa
aaagaacagcagctgcctccacgagctgtacaaattgtttcccacccattttttggcagg
gtagtattgactgctggaccagctcagtttgggctggatctgtctaaacataaagagaca
agaggatttgttgcaagcagtaaaccatccaatggttgttcagagcttactaacccagag
gcagtgatgggaaaaatcgcactgatacaaagaggacagtgcatgtttgcagaaaaggca
cgcaacatccagaatgctggagccattggtggcattgttattgatgacaatgaggggagc
agcagtgatactgcccctctgttccagatggcaggtgatggaaaggatacagatgacatc
aagatccccatgctgttcttattcagcaaagaaggaagtatcatactggatgccatccgg
gaatatgaggaggtagaagtgctcctctctgataaagcaaaagatcgagatcctgaaatg
gaaaatgaagaacaaccatcctctgaaaatgattctcagaatcagagtggtgaacagatt
tcatcaagttctcaggaggttgatttggttgatcaagagtcttctgaggaaaattctcta
aattctcacccagaatcattatctctagcagatatggacaatgctgcaagcatttcccct
tctgaacagacttctaatcccacagaaaaccatgagactacaaatcttaatggtgaatgt
acagatttagataaccagcttcaagaacaatcagaaactgaggaagattccaatcctaat
gttagctggggtaaaaaggtccagcctatagactccatattagcagactggaatgaagat
atagaagcatttgaaatgatggagaaggatgagctatga

KEGG   Homo sapiens (human): 9695
Entry
9695              CDS       T01001                                 

Symbol
EDEM1, EDEM
Name
(RefSeq) ER degradation enhancing alpha-mannosidase like protein 1
  KO
K10084  ER degradation enhancer, mannosidase alpha-like 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    9695 (EDEM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:hsa04091]
    9695 (EDEM1)
Lectins [BR:hsa04091]
 M-type lectins
  9695 (EDEM1)
SSDB
Motif
Pfam: Glyco_hydro_47
Other DBs
NCBI-GeneID: 9695
NCBI-ProteinID: NP_055489
OMIM: 607673
HGNC: 18967
Ensembl: ENSG00000134109
Vega: OTTHUMG00000154896
Pharos: Q92611(Tbio)
UniProt: Q92611 A0A024R2D5
Position
3p26.1
AA seq 657 aa
MQWRALVLGLVLLRLGLHGVLWLVFGLGPSMGFYQRFPLSFGFQRLRSPDGPASPTSGPV
GRPGGVSGPSWLQPPGTGAAQSPRKAPRRPGPGMCGPANWGYVLGGRGRGPDEYEKRYSG
AFPPQLRAQMRDLARGMFVFGYDNYMAHAFPQDELNPIHCRGRGPDRGDPSNLNINDVLG
NYSLTLVDALDTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRVLGSLLSAHRI
ITDSKQPFGDMTIKDYDNELLYMAHDLAVRLLPAFENTKTGIPYPRVNLKTGVPPDTNNE
TCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNVVNIQTGHWVG
KQSGLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQNYLRRGREACNEGEGDPPLY
VNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYGALPERYNWQL
QAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVKCGYATLHHVIDK
STEDRMESFFLSETCKYLYLLFDEDNPVHKSGTRYMFTTEGHIVSVDEHLRELPWKEFFS
EEGGQDQGGKSVHRPKPHELKVINSSSNCNRVPDERRYSLPLKSIYMRQIDQMVGLI
NT seq 1974 nt   +upstreamnt  +downstreamnt
atgcaatggcgagcgctcgtcctggggctggtgctcctccggcttggcctccatggagta
ttgtggctcgtcttcgggctggggcccagcatgggcttctaccagcgctttccgctcagc
ttcggcttccagcgtctgaggagccccgacggccccgcgtcgcccacctcggggcccgtg
ggccggcctgggggggtatccgggccgtcgtggctgcagccgccggggaccggggcagcg
cagagcccgcgcaaggctccgcggcgtcctgggccggggatgtgcggcccagccaactgg
ggctacgtgctgggcggccggggccgcggcccggacgagtacgagaagcgctacagcggc
gccttccctccgcagctgcgtgcccagatgcgcgacctggcacggggcatgttcgtcttt
ggctacgacaactacatggctcacgccttcccccaggacgagctcaaccccatccactgc
cgcggccgtgggcccgaccgcggggacccttcaaatctgaacatcaatgatgtactaggg
aactactcattgactcttgttgatgcattggatacacttgcaataatgggaaattcatcc
gagttccagaaagccgtcaagttagtgatcaacacagtttcatttgacaaagattccacc
gtccaagtctttgaggccacgataagggtcctgggaagcctcctttctgctcacagaata
ataactgactccaagcagccctttggtgacatgacaattaaggactatgataatgagttg
ttatacatggcccatgacctggcggtgcggctcctccctgcttttgaaaacaccaagaca
gggattccatatcctcgggtgaatctaaagacaggagttcctcctgacaccaataatgag
acatgcacagcgggagccggttccctcctggtggaatttgggattctgagtcgactcctg
ggggactccacatttgagtgggtggccagacgagcagtgaaagccctttggaacctccgg
agcaatgatacaggattactaggcaatgtcgtgaacattcagacgggccactgggttgga
aagcagagtggcctgggtgccgggctggactccttctatgaatacctcttgaaatcttac
attctctttggagaaaaagaagacctagaaatgtttaatgctgcatatcagagtattcag
aactacttaagaagagggcgggaagcctgcaatgaaggagaaggagaccctccactctat
gtcaacgtgaacatgttcagtgggcagctgatgaacacctggattgactctctgcaggcc
tttttccctggactgcaggtgctgataggagatgtggaagatgccatctgccttcatgcc
ttctactatgccatatggaaacgatatggtgccctccctgagagatataactggcagctg
caggcccctgacgttctcttctacccactgagaccagagttagtggaatccacatatctc
ctctaccaggcaaccaagaatcccttctacctccatgtaggaatggatattctgcagagt
ctggaaaagtacacaaaagtcaagtgtgggtacgccacgctgcatcacgtcattgacaag
tccacagaagaccggatggagagcttctttctcagtgagacctgtaaatatttgtatctg
ctgtttgatgaagacaatccagtacacaagtctggaaccagatacatgttcacaacagag
ggacacattgtatctgtggatgagcatcttcgggaattgccatggaaggaattcttctct
gaagagggagggcaggaccaagggggaaagtctgtgcacaggccgaaacctcatgagtta
aaagtcatcaactccagctccaactgcaatcgtgtacctgatgagaggaggtactccctg
cccttaaagagcatctacatgcgacagattgaccagatggttggtttgatttga

DBGET integrated database retrieval system