KEGG   Homo sapiens (human): 55742Help
Entry
55742             CDS       T01001                                 

Gene name
PARVA, CH-ILKBP, MXRA2
Definition
(RefSeq) parvin alpha
  KO
K06275  parvin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    55742 (PARVA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    55742 (PARVA)
   04147 Exosome [BR:hsa04147]
    55742 (PARVA)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     55742 (PARVA)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   55742 (PARVA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CH CAMSAP_CH CH_2 Sfi1 FlaG
Motif
Other DBs
NCBI-GeneID: 55742
NCBI-ProteinID: NP_060692
OMIM: 608120
HGNC: 14652
Ensembl: ENSG00000197702
Vega: OTTHUMG00000165778
Pharos: Q9NVD7(Tbio)
UniProt: Q9NVD7 J3KNQ4
Structure
PDB: 

Position
11p15.3
AA seq 372 aa AA seqDB search
MATSPQKSPSVPKSPTPKSPPSRKKDDSFLGKLGGTLARRKKAKEVSELQEEGMNAINLP
LSPIPFELDPEDTMLEENEVRTMVDPNSRSDPKLQELMKVLIDWINDVLVGERIIVKDLA
EDLYDGQVLQKLFEKLESEKLNVAEVTQSEIAQKQKLQTVLEKINETLKLPPRSIKWNVD
SVHAKSLVAILHLLVALSQYFRAPIRLPDHVSIQVVVVQKREGILQSRQIQEEITGNTEA
LSGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTELETQFADGVYLVLLM
GLLEGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPRPEDIVNCDLKSTLRV
LYNLFTKYRNVE
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggccacctccccgcagaagtcgccttctgtccccaagtctcccactcccaagtcgccc
ccgtcccgcaagaaagatgattccttcttggggaaactcggagggaccctggcccggagg
aagaaagccaaggaggtgtccgagctgcaggaggagggaatgaacgccatcaacctgccc
ctcagcccaattccctttgagctggaccccgaggacacgatgctggaggagaatgaggtg
cgaacaatggtggatccaaactcacgcagtgaccccaagcttcaagaactgatgaaggta
ttaattgactggattaatgatgtgttggttggagaaagaatcattgtgaaagacctagct
gaagatttgtatgatggacaagtcctgcagaagcttttcgagaaactggagagtgagaag
ctaaatgtggctgaggtcacccagtcagagattgctcagaagcaaaaactgcagactgtc
ctggagaagatcaatgaaaccctgaaacttcctcccaggagcatcaagtggaatgtggat
tctgttcatgccaagagcctggtggccatcttacacctgctcgttgctctgtctcagtat
ttccgcgcaccaattcgactcccagaccatgtttccatccaagtggttgtggtccagaaa
cgagaaggaatcctccagtctcggcaaatccaagaggaaataactggtaacacagaggct
ctttccgggaggcatgaacgtgatgcctttgacaccttgttcgaccatgccccagacaag
ctgaatgtggtgaaaaagacactcatcactttcgtgaacaagcacctgaataaactgaac
ctggaggtcacagaactggaaacccagtttgcagatggggtgtacctggtgctgctcatg
gggctcctggagggctactttgtgcccctgcacagcttcttcctgaccccggacagcttt
gaacagaaggtcttgaatgtctcctttgcctttgagctcatgcaagatggagggttggaa
aagccaaaaccgcggccagaagacatagtcaactgtgacctgaaatctacactacgagtg
ttgtacaacctcttcaccaagtaccgtaacgtggagtga

DBGET integrated database retrieval system