KEGG   Homo sapiens (human): 55748Help
Entry
55748             CDS       T01001                                 

Gene name
CNDP2, CN2, CPGL, HEL-S-13, HsT2298, PEPA
Definition
(RefSeq) carnosine dipeptidase 2
  KO
K08660  cytosolic nonspecific dipeptidase [EC:3.4.13.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00330  Arginine and proline metabolism
hsa00340  Histidine metabolism
hsa00410  beta-Alanine metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    55748 (CNDP2)
   00340 Histidine metabolism
    55748 (CNDP2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    55748 (CNDP2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    55748 (CNDP2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    55748 (CNDP2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.13  Dipeptidases
    3.4.13.18  cytosol nonspecific dipeptidase
     55748 (CNDP2)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M20
   55748 (CNDP2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   55748 (CNDP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-GeneID: 55748
NCBI-ProteinID: NP_060705
OMIM: 169800
HGNC: 24437
Ensembl: ENSG00000133313
Vega: OTTHUMG00000132853
Pharos: Q96KP4(Tbio)
UniProt: Q96KP4
Structure
PDB: 

Position
18q22.3
AA seq 475 aa AA seqDB search
MAALTTLFKYIDENQDRYIKKLAKWVAIQSVSAWPEKRGEIRRMMEVAAADVKQLGGSVE
LVDIGKQKLPDGSEIPLPPILLGRLGSDPQKKTVCIYGHLDVQPAALEDGWDSEPFTLVE
RDGKLYGRGSTDDKGPVAGWINALEAYQKTGQEIPVNVRFCLEGMEESGSEGLDELIFAR
KDTFFKDVDYVCISDNYWLGKKKPCITYGLRGICYFFIEVECSNKDLHSGVYGGSVHEAM
TDLILLMGSLVDKRGNILIPGINEAVAAVTEEEHKLYDDIDFDIEEFAKDVGAQILLHSH
KKDILMHRWRYPSLSLHGIEGAFSGSGAKTVIPRKVVGKFSIRLVPNMTPEVVGEQVTSY
LTKKFAELRSPNEFKVYMGHGGKPWVSDFSHPHYLAGRRAMKTVFGVEPDLTREGGSIPV
TLTFQEATGKNVMLLPVGSADDGAHSQNEKLNRYNYIEGTKMLAAYLYEVSQLKD
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggcggccctcactaccctgtttaagtacatagatgaaaatcaggatcgctacattaag
aaactcgcaaaatgggtggctatccagagtgtgtctgcgtggccggagaagagaggcgaa
atcaggaggatgatggaagttgctgctgcagatgttaagcagttggggggctctgtggaa
ctggtggatatcggaaaacaaaagctccctgatggctcggagatcccgctccctcctatt
ctgctcggcaggctgggctccgacccacagaagaagaccgtgtgcatttacgggcacctg
gatgtgcagcctgcagccctggaggacggctgggacagcgagcccttcaccctggtggag
cgagacggcaagctgtatgggagaggttcgactgatgataagggcccggtggccggctgg
ataaacgccctggaagcgtatcagaaaacaggccaggagattcctgtcaacgtccgattc
tgcctcgaaggcatggaggagtcaggctctgagggcctagacgagctgatttttgcccgg
aaagacacattctttaaggatgtggactatgtctgcatttctgacaattactggctggga
aagaagaagccctgcatcacctacggcctcaggggcatttgctactttttcatcgaggtg
gagtgcagcaacaaagacctccattctggggtgtacgggggctcggtgcatgaggccatg
actgatctcattttgctgatgggctctttggtggacaagagggggaacatcctgatcccc
ggcattaacgaggccgtggccgccgtcacggaagaggagcacaagctgtacgacgacatc
gactttgacatagaggagtttgccaaggatgtgggggcgcagatcctcctgcacagccac
aagaaagacatcctcatgcaccgatggcggtacccgtctctgtccctccatggcatcgaa
ggcgccttctctgggtctggggccaagaccgtgattcccaggaaggtggttggcaagttc
tccatcaggctcgtgccgaacatgactcctgaagtcgtcggcgagcaggtcacaagctac
ctaactaagaagtttgctgaactacgcagccccaatgagttcaaggtgtacatgggccac
ggtgggaagccctgggtctccgacttcagtcaccctcattacctggctgggagaagagcc
atgaagacagtttttggtgttgagccagacttgaccagggaaggcggcagtattcccgtg
accttgacctttcaggaggccacgggcaagaacgtcatgctgctgcctgtggggtcagcg
gatgacggagcccactcccagaatgaaaagctcaacaggtataactacatagagggaacc
aagatgctggccgcgtacctgtatgaggtctcccagctgaaggactag

DBGET integrated database retrieval system