KEGG   Homo sapiens (human): 55749
Entry
55749             CDS       T01001                                 
Symbol
CCAR1
Name
(RefSeq) cell division cycle and apoptosis regulator 1
  KO
K25827  cell division cycle and apoptosis regulator protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    55749 (CCAR1)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    Others
     55749 (CCAR1)
SSDB
Motif
Pfam: DBC1 S1-like LAIKA BURAN SAP Tautomerase_2
Other DBs
NCBI-GeneID: 55749
NCBI-ProteinID: NP_060707
OMIM: 612569
HGNC: 24236
Ensembl: ENSG00000060339
Pharos: Q8IX12(Tbio)
UniProt: Q8IX12
Position
10:68721239..68792377
AA seq 1150 aa
MAQFGGQKNPPWATQFTATAVSQPAALGVQQPSLLGASPTIYTQQTALAAAGLTTQTPAN
YQLTQTAALQQQAAAAAAALQQQYSQPQQALYSVQQQLQQPQQTLLTQPAVALPTSLSLS
TPQPTAQITVSYPTPRSSQQQTQPQKQRVFTGVVTKLHDTFGFVDEDVFFQLSAVKGKTP
QVGDRVLVEATYNPNMPFKWNAQRIQTLPNQNQSQTQPLLKTPPAVLQPIAPQTTFGVQT
QPQPQSLLQAQISAASITPLLQTQPQPLLQQPQQKAGLLQPPVRIVSQPQPARRLDPPSR
FSGRNDRGDQVPNRKDDRSRERERERRRSRERSPQRKRSRERSPRRERERSPRRVRRVVP
RYTVQFSKFSLDCPSCDMMELRRRYQNLYIPSDFFDAQFTWVDAFPLSRPFQLGNYCNFY
VMHREVESLEKNMAILDPPDADHLYSAKVMLMASPSMEDLYHKSCALAEDPQELRDGFQH
PARLVKFLVGMKGKDEAMAIGGHWSPSLDGPDPEKDPSVLIKTAIRCCKALTGIDLSVCT
QWYRFAEIRYHRPEETHKGRTVPAHVETVVLFFPDVWHCLPTRSEWETLSRGYKQQLVEK
LQGERKEADGEQDEEEKDDGEAKEISTPTHWSKLDPKTMKVNDLRKELESRALSSKGLKS
QLIARLTKQLKVEEQKEEQKELEKSEKEEDEDDDRKSEDDKEEEERKRQEEIERQRRERR
YILPDEPAIIVHPNWAAKSGKFDCSIMSLSVLLDYRLEDNKEHSFEVSLFAELFNEMLQR
DFGVRIYKSLLSLPEKEDKKEKDKKSKKDERKDKKEERDDETDEPKPKRRKSGDDKDKKE
DRDERKKEDKRKDDSKDDDETEEDNNQDEYDPMEAEEAEDEEDDRDEEEMTKRDDKRDIN
RYCKERPSKDKEKEKTQMITINRDLLMAFVYFDQSHCGYLLEKDLEEILYTLGLHLSRAQ
VKKLLNKVVLRESCFYRKLTDTSKDEENHEESESLQEDMLGNRLLLPTPTVKQESKDVEE
NVGLIVYNGAMVDVGSLLQKLEKSEKVRAEVEQKLQLLEEKTDEDEKTILNLENSNKSLS
GELREVKKDLSQLQENLKISENMNLQFENQMNKTIRNLSTVMDEIHTVLKKDNVKNEDKD
QKSKENGASV
NT seq 3453 nt   +upstreamnt  +downstreamnt
atggctcaatttggaggacagaagaatccgccatgggctactcagtttacagccactgca
gtatcacagccagctgcactgggtgttcaacagccatcactccttggagcatctcctacc
atttatacacagcaaactgcattggcagcagcaggccttaccacacaaactccagcaaac
tatcagttaacacaaactgctgcattgcagcaacaagccgcagctgcagcagctgcatta
caacagcaatattcacaacctcagcaggccctgtatagtgtgcaacaacagttacagcaa
ccccagcaaaccctcttaacacagccagctgttgcactgcctacaagccttagcctgtct
actcctcagccaacagcacaaataactgtatcatatccaacaccaaggtccagtcaacag
caaacccagcctcagaagcagcgtgttttcacaggggtggttacaaaactacatgatacg
tttggatttgtggatgaagatgtattctttcagcttagtgctgtcaaagggaaaaccccc
caagtaggtgacagagtattggttgaagctacttataatcctaatatgccttttaaatgg
aatgcacagagaattcaaacactaccaaatcagaatcagtcgcaaacccagccattactg
aagactcctcctgctgtacttcagccaattgcaccacagacaacatttggtgttcagact
cagccccagccccagtcactgctgcaggcacagatttcagcagcttctattacaccacta
ttgcagactcaaccacagcccttattacagcagcctcagcaaaaagctggtttattgcag
cctcctgttcgtatagtttcacagccacaaccggcacgacgattagatcccccatcccga
ttttcaggaagaaatgacagaggggatcaagtgcctaacagaaaagatgatcgaagtcgt
gagagagagagagaaagacgtagatcgagagaaagatcacctcagaggaaacgttcccgg
gaaagatctccacgaagagagcgagagcgatcacctcggagagttcgacgtgttgttcca
cgttacacagttcagttttcaaagttttctttagattgtcccagttgtgacatgatggaa
ctaaggcgccgttatcaaaatttgtatatacctagtgacttttttgatgctcaatttaca
tgggtggatgctttccctttgtcaagaccatttcagctgggaaattactgcaatttttat
gtaatgcacagagaagtagagtccttagaaaaaaatatggccattcttgatccaccagat
gctgaccacttatacagtgcaaaggtaatgctgatggctagccctagtatggaagattta
tatcataagtcatgtgctcttgctgaggacccacaagaacttcgagatggattccaacat
cctgctagacttgttaagtttttagtgggcatgaaaggcaaggatgaagctatggccatt
ggaggccactggtctccttcgttggatggaccagacccagaaaaagatccctctgtgttg
attaagactgctattcgttgttgtaaggctctgacaggcattgatctaagtgtgtgcaca
caatggtaccgttttgcagagattcgctaccatcgccctgaggagacccacaaggggcgt
acagttccagctcatgtggagacagtggttttatttttcccggatgtttggcattgcctt
cccacccgctcagagtgggaaaccctctcccgaggatacaagcagcagctggtcgagaag
cttcagggtgaacgcaaggaggctgatggagaacaggatgaagaagagaaggatgatggt
gaagctaaagaaatttctacacctacccattggtctaaacttgatccaaagacaatgaag
gtaaatgacctccgaaaagaattagaaagtcgagctcttagttccaaaggattaaaatcc
cagttaatagcccgattgacaaaacagcttaaagtagaggaacaaaaagaagaacagaag
gagttagagaaatctgaaaaagaagaggatgaggatgatgataggaaatctgaagacgat
aaagaggaagaagaaaggaaacgtcaagaggaaatagaacgccagcgtcgagaaagaaga
tatattttgcctgatgaaccggccatcattgtacatccaaattgggctgcaaaaagtggc
aagtttgattgtagcatcatgtctttgagtgtcctattggactacagattagaggataat
aaagaacattcatttgaggtttcattgtttgcggaacttttcaacgaaatgcttcaaaga
gattttggtgtccgtatatacaaatcattactgtctcttcctgagaaagaggacaaaaaa
gaaaaggataaaaaaagcaaaaaagatgagagaaaagataaaaaagaagaaagagatgat
gaaactgatgaaccaaaacccaaacggagaaaatcaggcgatgataaagataaaaaagaa
gatagagatgaaaggaagaaagaagataaaagaaaagatgattctaaagatgatgatgaa
actgaagaagataacaatcaagatgaatatgaccctatggaagcagaagaagctgaggat
gaagaagatgatagggatgaggaagaaatgaccaaacgagatgacaaaagagatatcaac
agatactgcaaggagaggccctctaaagataaggaaaaagaaaagactcaaatgatcaca
attaacagagatctgttaatggcttttgtttattttgatcaaagtcattgtggttacctt
cttgaaaaggatttggaagaaatactttatactcttggactacatctttctcgggctcag
gtaaagaagcttcttaataaagtagtgctccgtgaatcttgcttttaccggaaattaaca
gacacctcaaaagatgaagagaaccatgaagagtctgagtcattgcaggaagatatgcta
ggaaacagattattacttccaacaccaacagtaaagcaggaatcaaaggatgtggaagaa
aatgttggcctcattgtgtacaatggtgcaatggtagatgtaggaagcctcttgcaaaaa
ttggaaaagagcgaaaaagtaagagctgaggtagaacagaagctgcagttactagaagaa
aaaacagatgaagatgaaaaaaccatattaaatttggagaattccaacaaaagcctctct
ggtgaactcagagaagttaaaaaggaccttagtcagttacaagaaaacttaaagatttcg
gaaaacatgaatttacaatttgaaaaccaaatgaataagacaatcagaaacttatctacg
gtaatggatgaaatccacactgttctcaagaaggataatgtaaagaatgaagacaaagat
caaaaatccaaggagaatggtgccagtgtatga

DBGET integrated database retrieval system