KEGG   Homo sapiens (human): 55751Help
Entry
55751             CDS       T01001                                 

Gene name
TMEM184C, TMEM34
Definition
(RefSeq) transmembrane protein 184C
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Solute_trans_a
Motif
Other DBs
NCBI-GeneID: 55751
NCBI-ProteinID: NP_060711
OMIM: 613937
HGNC: 25587
Ensembl: ENSG00000164168
Vega: OTTHUMG00000161358
Pharos: Q9NVA4(Tbio)
UniProt: Q9NVA4
Position
4q31.23
AA seq 438 aa AA seqDB search
MPCTCTWRNWRQWIRPLVAVIYLVSIVVAVPLCVWELQKLEVGIHTKAWFIAGIFLLLTI
PISLWVILQHLVHYTQPELQKPIIRILWMVPIYSLDSWIALKYPGIAIYVDTCRECYEAY
VIYNFMGFLTNYLTNRYPNLVLILEAKDQQKHFPPLCCCPPWAMGEVLLFRCKLGVLQYT
VVRPFTTIVALICELLGIYDEGNFSFSNAWTYLVIINNMSQLFAMYCLLLFYKVLKEELS
PIQPVGKFLCVKLVVFVSFWQAVVIALLVKVGVISEKHTWEWQTVEAVATGLQDFIICIE
MFLAAIAHHYTFSYKPYVQEAEEGSCFDSFLAMWDVSDIRDDISEQVRHVGRTVRGHPRK
KLFPEDQDQNEHTSLLSSSSQDAISIASSMPPSPMGHYQGFGHTVTPQTTPTTAKISDEI
LSDTIGEKKEPSDKSVDS
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgccttgcacttgtacctggaggaactggagacagtggattcgacctttagtagcggtc
atctacctggtgtcaatagtggttgcggttcccctatgcgtgtgggaattacagaaactg
gaggttggaatacacaccaaggcttggtttattgctggaatctttttgctgttgactatt
cctatatcactgtgggtgatattgcaacacttagtgcattatacacaacctgaactacaa
aaaccaataataaggattctttggatggtacctatttacagtttagatagttggatagct
ttgaaatatcccggaattgcaatatatgtggatacctgcagagaatgctatgaagcttat
gtaatttacaactttatgggattccttaccaattatctaactaaccggtatccaaatctg
gtattaatccttgaagccaaagatcaacagaaacatttccctcctttatgttgctgtcca
ccatgggctatgggagaagtattgctgtttaggtgcaaactaggtgtattacagtacaca
gttgtcagacctttcaccaccatcgttgctttaatctgtgagctgcttggtatatatgac
gaagggaactttagcttttcaaatgcttggacttatttggttataataaacaacatgtca
cagttgtttgccatgtattgtctcctgctcttttataaagtactaaaagaagaactgagc
ccaatccaacctgttggcaaatttctttgtgtaaagctggtggtttttgtttctttttgg
caagcagtagttattgctttgttggtaaaagttggcgttatttctgaaaagcatacgtgg
gaatggcaaactgtagaagctgtggccaccggactccaggattttattatctgtattgag
atgttcctcgctgccattgctcatcattacacattctcatataaaccatatgtccaagaa
gcagaagagggctcatgctttgattcctttcttgccatgtgggatgtctcagatattaga
gatgatatttctgaacaagtaaggcatgttggacggacagtcaggggacatcccaggaaa
aaattgtttcccgaggatcaagatcaaaatgaacatacaagtttattatcatcatcatca
caagatgcaatttccattgcttcttctatgccaccttcacccatgggtcactaccaaggg
tttggacacactgtgactccccagactacacctaccacagctaagatatctgatgaaatc
cttagtgatactataggagagaaaaaagaaccttcagataaatccgtggattcctga

DBGET integrated database retrieval system