KEGG   Homo sapiens (human): 55754Help
Entry
55754             CDS       T01001                                 

Gene name
TMEM30A, C6orf67, CDC50A
Definition
(RefSeq) transmembrane protein 30A
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: CDC50
Motif
Other DBs
NCBI-GeneID: 55754
NCBI-ProteinID: NP_060717
OMIM: 611028
HGNC: 16667
Ensembl: ENSG00000112697
Vega: OTTHUMG00000015050
Pharos: Q9NV96(Tbio)
UniProt: Q9NV96
Position
6q14.1
AA seq 361 aa AA seqDB search
MAMNYNAKDEVDGGPPCAPGGTAKTRRPDNTAFKQQRLPAWQPILTAGTVLPIFFIIGLI
FIPIGIGIFVTSNNIREIEIDYTGTEPSSPCNKCLSPDVTPCFCTINFTLEKSFEGNVFM
YYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKECEPYRRNEDKPIAPCGAIANSMFN
DTLELFLIGNDSYPIPIALKKKGIAWWTDKNVKFRNPPGGDNLEERFKGTTKPVNWLKPV
YMLDSDPDNNGFINEDFIVWMRTAALPTFRKLYRLIERKSDLHPTLPAGRYSLNVTYNYP
VHYFDGRKRMILSTISWMGGKNPFLGIAYIAVGSISFLLGVVLLVINHKYRNSSNTADIT
I
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgaactataacgcgaaggatgaagtggacggtgggcccccgtgtgctccgggg
ggcaccgcgaagactcggagaccggataacacggccttcaaacagcaacggctgccagct
tggcagcccatccttacggctggcacggtgctacctattttcttcatcatcggtctcatc
ttcattcccatcggcattggcatttttgtcacctccaacaacatccgcgagatcgagatt
gattataccggaacagagccttccagtccctgtaataaatgtttatctccggatgtgaca
ccttgcttttgtaccattaacttcacactggaaaagtcatttgagggcaacgtgtttatg
tattatggactgtctaatttctatcaaaaccatcgtcgttacgtgaaatctcgagatgat
agtcaactaaatggagattctagtgctttgcttaatcccagtaaggaatgtgaaccttat
cgaagaaatgaagacaaaccaattgctccttgtggagctattgccaacagcatgtttaat
gatacattagaattgtttctcattggcaatgattcttatcctatacctatcgctttgaaa
aagaaaggtattgcttggtggacagataaaaatgtgaaattcagaaatccccctggagga
gacaacctggaagaacgatttaaaggtacaacaaagcctgtgaactggcttaaaccagtt
tacatgctggattctgacccagataataatggattcataaatgaggattttattgtttgg
atgcgtactgcagcattacctacttttcgcaagttgtatcgtcttatagaaaggaaaagt
gatttacatccaacattaccagctggccgatactctttgaatgtcacatacaattaccct
gtacattattttgatggacgaaaacggatgatcttgagcactatttcatggatgggagga
aaaaatccatttttggggattgcttacatcgctgttggatccatctccttccttctggga
gttgtactgctagtaattaatcataaatatagaaacagtagtaatacagctgacattacc
atttaa

DBGET integrated database retrieval system