KEGG   Homo sapiens (human): 55754
Entry
55754             CDS       T01001                                 
Symbol
TMEM30A, C6orf67, CDC50A
Name
(RefSeq) transmembrane protein 30A
  KO
K26935  cell cycle control protein 50A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04148  Efferocytosis
Network
nt06535  Efferocytosis
  Element
N01752  Translocation of phosphatidylserine to the inner leaflet
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04148 Efferocytosis
    55754 (TMEM30A)
SSDB
Motif
Pfam: CDC50 60KD_IMP
Other DBs
NCBI-GeneID: 55754
NCBI-ProteinID: NP_060717
OMIM: 611028
HGNC: 16667
Ensembl: ENSG00000112697
UniProt: Q9NV96
Position
6:complement(75252924..75284792)
AA seq 361 aa
MAMNYNAKDEVDGGPPCAPGGTAKTRRPDNTAFKQQRLPAWQPILTAGTVLPIFFIIGLI
FIPIGIGIFVTSNNIREIEIDYTGTEPSSPCNKCLSPDVTPCFCTINFTLEKSFEGNVFM
YYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKECEPYRRNEDKPIAPCGAIANSMFN
DTLELFLIGNDSYPIPIALKKKGIAWWTDKNVKFRNPPGGDNLEERFKGTTKPVNWLKPV
YMLDSDPDNNGFINEDFIVWMRTAALPTFRKLYRLIERKSDLHPTLPAGRYSLNVTYNYP
VHYFDGRKRMILSTISWMGGKNPFLGIAYIAVGSISFLLGVVLLVINHKYRNSSNTADIT
I
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggcgatgaactataacgcgaaggatgaagtggacggtgggcccccgtgtgctccgggg
ggcaccgcgaagactcggagaccggataacacggccttcaaacagcaacggctgccagct
tggcagcccatccttacggctggcacggtgctacctattttcttcatcatcggtctcatc
ttcattcccatcggcattggcatttttgtcacctccaacaacatccgcgagatcgagatt
gattataccggaacagagccttccagtccctgtaataaatgtttatctccggatgtgaca
ccttgcttttgtaccattaacttcacactggaaaagtcatttgagggcaacgtgtttatg
tattatggactgtctaatttctatcaaaaccatcgtcgttacgtgaaatctcgagatgat
agtcaactaaatggagattctagtgctttgcttaatcccagtaaggaatgtgaaccttat
cgaagaaatgaagacaaaccaattgctccttgtggagctattgccaacagcatgtttaat
gatacattagaattgtttctcattggcaatgattcttatcctatacctatcgctttgaaa
aagaaaggtattgcttggtggacagataaaaatgtgaaattcagaaatccccctggagga
gacaacctggaagaacgatttaaaggtacaacaaagcctgtgaactggcttaaaccagtt
tacatgctggattctgacccagataataatggattcataaatgaggattttattgtttgg
atgcgtactgcagcattacctacttttcgcaagttgtatcgtcttatagaaaggaaaagt
gatttacatccaacattaccagctggccgatactctttgaatgtcacatacaattaccct
gtacattattttgatggacgaaaacggatgatcttgagcactatttcatggatgggagga
aaaaatccatttttggggattgcttacatcgctgttggatccatctccttccttctggga
gttgtactgctagtaattaatcataaatatagaaacagtagtaatacagctgacattacc
atttaa

DBGET integrated database retrieval system