KEGG   Homo sapiens (human): 55755
Entry
55755             CDS       T01001                                 
Symbol
CDK5RAP2, C48, Cep215, MCPH3
Name
(RefSeq) CDK5 regulatory subunit associated protein 2
  KO
K16542  CDK5 regulatory subunit-associated protein 2
Organism
hsa  Homo sapiens (human)
Disease
H00269  Primary microcephaly
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    55755 (CDK5RAP2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Pericentriolar materials (PCM)
    Other PCM proteins
     55755 (CDK5RAP2)
   Centrosome duplication proteins
    Regulators of centriole replication
     55755 (CDK5RAP2)
SSDB
Motif
Pfam: Cnn_1N
Other DBs
NCBI-GeneID: 55755
NCBI-ProteinID: NP_060719
OMIM: 608201
HGNC: 18672
Ensembl: ENSG00000136861
Pharos: Q96SN8(Tbio)
UniProt: Q96SN8 B3KVI2
Structure
Position
9:complement(120388875..120580167)
AA seq 1893 aa
MMDLVLEEDVTVPGTLSGCSGLVPSVPDDLDGINPNAGLGNGLLPNVSEETVSPTRARNM
KDFENQITELKKENFNLKLRIYFLEERMQQEFHGPTEHIYKTNIELKVEVESLKRELQER
EQLLIKASKAVESLAEAGGSEIQRVKEDARKKVQQVEDLLTKRILLLEKDVTAAQAELEK
AFAGTETEKALRLRLESKLSEMKKMHEGDLAMALVLDEKDRLIEELKLSLKSKEALIQCL
KEEKSQMACPDENVSSGELRGLCAAPREEKERETEAAQMEHQKERNSFEERIQALEEDLR
EKEREIATEKKNSLKRDKAIQGLTMALKSKEKKVEELNSEIEKLSAAFAKAREALQKAQT
QEFQGSEDYETALSGKEALSAALRSQNLTKSTENHRLRRSIKKITQELSDLQQERERLEK
DLEEAHREKSKGDCTIRDLRNEVEKLRNEVNEREKAMENRYKSLLSESNKKLHNQEQVIK
HLTESTNQKDVLLQKFNEKDLEVIQQNCYLMAAEDLELRSEGLITEKCSSQQPPGSKTIF
SKEKKQSSDYEELIQVLKKEQDIYTHLVKSLQESDSINNLQAELNKIFALRKQLEQDVLS
YQNLRKTLEEQISEIRRREEESFSLYSDQTSYLSICLEENNRFQVEHFSQEELKKKVSDL
IQLVKELYTDNQHLKKTIFDLSCMGFQGNGFPDRLASTEQTELLASKEDEDTIKIGEDDE
INFLSDQHLQQSNEIMKDLSKGGCKNGYLRHTESKISDCDGAHAPGCLEEGAFINLLAPL
FNEKATLLLESRPDLLKVVRELLLGQLFLTEQEVSGEHLDGKTEKTPKQKGELVHFVQTN
SFSKPHDELKLSCEAQLVKAGEVPKVGLKDASVQTVATEGDLLRFKHEATREAWEEKPIN
TALSAEHRPENLHGVPGWQAALLSLPGITNREAKKSRLPILIKPSRSLGNMYRLPATQEV
VTQLQSQILELQGELKEFKTCNKQLHQKLILAEAVMEGRPTPDKTLLNAQPPVGAAYQDS
PGEQKGIKTTSSVWRDKEMDSDQQRSYEIDSEICPPDDLASLPSCKENPEDVLSPTSVAT
YLSSKSQPSAKVSVMGTDQSESINTSNETEYLKQKIHDLETELEGYQNFIFQLQKHSQCS
EAIITVLCGTEGAQDGLSKPKNGSDGEEMTFSSLHQVRYVKHVKILGPLAPEMIDSRVLE
NLKQQLEEQEYKLQKEQNLNMQLFSEIHNLQNKFRDLSPPRYDSLVQSQARELSLQRQQI
KDGHGICVISRQHMNTMIKAFEELLQASDVDYCVAEGFQEQLNQCAELLEKLEKLFLNGK
SVGVEMNTQNELMERIEEDNLTYQHLLPESPEPSASHALSDYETSEKSFFSRDQKQDNET
EKTSVMVNSFSQDLLMEHIQEIRTLRKRLEESIKTNEKLRKQLERQGSEFVQGSTSIFAS
GSELHSSLTSEIHFLRKQNQALNAMLIKGSRDKQKENDKLRESLSRKTVSLEHLQREYAS
VKEENERLQKEGSEKERHNQQLIQEVRCSGQELSRVQEEVKLRQQLLSQNDKLLQSLRVE
LKAYEKLDEEHRRLREASGEGWKGQDPFRDLHSLLMEIQALRLQLERSIETSSTLQSRLK
EQLARGAEKAQEGALTLAVQAVSIPEVPLQPDKHDGDKYPMESDNSFDLFDSSQAVTPKS
VSETPPLSGNDTDSLSCDSGSSATSTPCVSRLVTGHHLWASKNGRHVLGLIEDYEALLKQ
ISQGQRLLAEMDIQTQEAPSSTSQELGTKGPHPAPLSKFVSSVSTAKLTLEEAYRRLKLL
WRVSLPEDGQCPLHCEQIGEMKAEVTKLHKKLFEQEKKLQNTMKLLQLSKRQEKVIFDQL
VVTHKILRKARGNLELRPGGAHPGTCSPSRPGS
NT seq 5682 nt   +upstreamnt  +downstreamnt
atgatggacttggtgttggaagaggacgtcaccgtccctgggacgctcagcggctgcagt
ggccttgttcccagtgtaccagatgacctggatggcatcaaccccaatgctgggttggga
aatggtctgctcccaaatgtgtcagaagaaacagtgtctcccaccagagcacggaacatg
aaggactttgaaaatcaaatcactgaattgaagaaagaaaactttaacctaaagctccgc
atctatttccttgaggaaagaatgcaacaggaatttcatggccccactgaacatatctac
aaaactaacattgagctcaaggtggaagtagaaagtctgaagcgggaactccaggagaga
gagcagctgctcatcaaagcctccaaagcagttgagagcttagctgaagcaggtggctct
gaaatccagcgggtgaaagaagatgctcgaaagaaggtgcagcaggtggaagatctccta
actaaaagaatactccttttggaaaaggatgtgacagccgcccaggcagaactggaaaag
gcctttgcagggacagagacggagaaggctcttcggttgcgtttggaaagcaagctttca
gagatgaagaagatgcacgagggggacttggcgatggctctggtcctggatgagaaagac
agactgattgaggagttgaagctgtctttgaagagcaaagaagctttaattcagtgcctt
aaagaggagaaatctcagatggcatgtcctgatgagaatgtgtcatctggagagctccga
ggactttgtgctgctccaagggaagaaaaggagagagaaactgaggctgcacaaatggag
catcagaaggagagaaacagctttgaagagaggatccaggcacttgaagaggacctgaga
gagaaggaaagagaaattgctacagagaagaaaaatagtctaaagagggataaagccatt
cagggtttaaccatggcattaaaatcaaaggaaaaaaaggttgaagaacttaactctgaa
attgaaaagctcagtgctgcctttgctaaagccagagaggccctacagaaagcacagacc
caggaatttcaggggtctgaagactatgagactgctctatcaggaaaggaagccctttcg
gctgcgctgcgctcacaaaacctcaccaagagtacagagaaccacagactgcgtagaagc
attaagaagatcacccaggagctgagtgacttgcagcaggagagggagagactggagaag
gacctggaggaagcccatcgagagaagagcaaaggagactgcaccatccgtgatcttaga
aatgaagttgaaaaattacgcaatgaagtgaatgaaagagagaaagcaatggaaaatcgt
tacaagagtcttctgagtgaaagcaataaaaaattgcacaatcaagagcaagtgatcaaa
catctaacagaaagtaccaatcagaaggacgtgttgcttcagaaattcaatgaaaaagat
ttggaagtaatacagcagaactgctatttaatggctgcagaggatcttgagctcaggagt
gaaggcttaataacagaaaagtgctcttctcaacagccaccaggcagcaaaaccatcttc
tctaaggaaaagaaacaatcatcagactatgaagagctgattcaggtcttaaagaaagag
caggacatctatacccatctggtcaaatctctgcaggaatcagacagtatcaacaacctg
caggctgagttaaacaagatttttgccctgcggaagcaactggagcaggatgtgctttca
tatcagaatttgcggaagaccttggaggagcagatcagcgaaattcggaggcgggaagaa
gaatcattttcactttatagtgatcaaacatcttatctaagtatttgccttgaagaaaac
aatcggtttcaagtggaacatttttctcaagaagaacttaagaaaaaggtcagtgacctt
atacagctagtgaaggagctgtatacagacaaccagcacctgaagaaaaccatttttgat
ctctcctgcatgggtttccagggaaatgggtttccagatagacttgcgtctacagaacaa
acagagcttctggctagcaaggaggacgaggacacgatcaaaattggggaggatgacgag
attaatttcctgagtgaccagcatttgcagcagagtaatgagattatgaaagacctttcc
aaaggaggctgcaaaaatggatacttaaggcacacggagtctaagatttcagattgtgat
ggggcccacgcacctggctgcctagaagaaggtgcattcataaacctgcttgcccctttg
ttcaatgagaaggccacattattactggaatccaggccagaccttctgaaagtggtacgg
gaactgcttctgggacaactattcttgacagagcaggaagtttctggagaacaccttgat
ggtaaaactgagaagacacctaagcaaaaaggtgaacttgtacattttgtccaaaccaac
tcattttccaagccacatgatgaactgaagttgtcttgtgaggcccagctagtaaaggca
ggcgaagtgcccaaggtaggactgaaagatgcctcagtgcagactgtggccacggagggc
gacctgctgagattcaagcatgaagcaacaagagaggcttgggaagagaaaccgatcaac
actgcactcagcgcagagcatcggccagagaacctgcacggggtgcctgggtggcaggct
gccctcctttccctccctggtattaccaacagagaggctaagaagtcccgcttgccaatc
ctaataaaaccatcccggtcattaggaaatatgtatcgtctccctgccacccaggaggtg
gtgacgcagctgcagagccagatcttggagctgcagggggagctgaaggagtttaaaact
tgtaataagcaacttcaccaaaagttaattctggctgaagcagtgatggaggggaggcca
acgcccgacaaaacgttgctgaatgctcagccccctgtgggagcagcctaccaggacagc
ccaggagagcagaaaggaattaaaaccacatcttctgtctggagagacaaggaaatggac
agtgatcagcaaagaagctacgagattgactctgagatttgcccacctgatgaccttgcc
agcttgccatcatgcaaagaaaatcctgaagatgttctgagcccaacttcagtagctact
tacctgagttccaagagtcagccttctgctaaagtcagtgtgatggggactgatcagtca
gagagcattaatacctcaaatgagacagaatacttaaaacagaaaatccatgacttggaa
actgagctggaaggctaccagaatttcatatttcagcttcaaaagcactcccagtgcagt
gaggccataattacagttttgtgtgggacagaaggggcccaggatggcttgagcaagccc
aagaatggttctgatggggaagaaatgaccttttcaagtttgcaccaagtgcgatacgtg
aaacacgtgaaaatcctcggtccgctggccccagagatgattgacagcagggtgctggag
aacctcaaacagcagctggaggaacaggaatacaagctgcagaaggagcagaatttgaac
atgcaacttttcagtgagatccataatctgcagaataagttcagagatctctcacctccc
agatacgattcattagttcagtcccaagccagggagctctcccttcaacggcagcagatt
aaggatggccatggcatctgtgtcatctcccgtcaacacatgaacaccatgattaaggca
tttgaggagttgctgcaggccagtgatgtggattactgtgtggccgagggtttccaggaa
cagctgaatcaatgtgctgagctgctggagaaattggaaaagctatttctcaacggaaaa
tcagttggagtggaaatgaacacccagaatgaactgatggagaggattgaggaagacaac
ttaacctaccaacatcttctgcctgaatctcctgagccttcagcctctcatgcgctctct
gattatgaaacatctgaaaagtccttcttctcacgagaccagaagcaagataatgagaca
gagaagacttcagttatggtgaacagtttttctcaagacttactaatggaacacatacag
gaaattcgaactttgagaaagcgtttagaagaatctattaaaacaaatgagaagctacgg
aaacagttggaacggcaaggatctgaatttgttcaaggttctacaagcatttttgcttct
ggttcagagcttcatagttctctaacatcagaaattcatttcttgaggaagcagaaccag
gccctcaatgcaatgctcattaaaggatccagagataaacagaaggagaatgacaaatta
cgagagtccctctccaggaagaccgtgagcctggagcaccttcagcgggagtatgccagc
gtgaaggaagaaaatgaaaggctgcagaaagaaggcagcgagaaggagagacacaaccag
cagctgatccaggaggtccgctgcagcggccaggagctgagcagggtgcaggaggaggtg
aagttgaggcagcagctgctctcacagaatgacaagctattgcagtctctccgagtggag
ctgaaggcgtatgagaagctggatgaagagcacaggagactgagagaggcgtcgggagaa
ggctggaaggggcaggatcctttcagggacctgcacagcctcctgatggagatccaggct
ctgcgcttgcaactagaaaggagcatcgaaaccagcagcactctgcagagcaggctcaag
gaacagctggcaaggggggcagagaaggcacaggaaggagccctcactctggctgtccaa
gccgtgtccatccctgaggtgccccttcagcctgacaaacacgatggtgacaaatatccc
atggaaagtgataattcatttgatctgtttgattcctcccaggcagtgacaccaaaatca
gtttcagagactcctccactctctgggaatgacacggactccctctcctgcgacagtggc
agttcggcaactagcactccgtgtgtgtcccgcctggtcactggccaccacctgtgggcc
agcaagaatggccgccatgtcctgggcctgattgaggactatgaggccctgctcaaacag
atcagccagggacagaggctccttgctgaaatggacattcaaacccaagaggctcccagc
tccacaagtcaagagctgggaacaaagggtccacacccagcaccactgagcaagtttgtg
agcagtgtgagcacggccaagctgaccctggaagaggcctacaggcggctgaagcttctc
tggagagtctcactccccgaggatggccagtgcccccttcactgtgagcagattggagaa
atgaaggcagaggtcaccaaactacataaaaaattgtttgaacaagaaaagaagttgcaa
aacaccatgaagcttttgcagctgagcaagcgccaggaaaaagtcatctttgatcaattg
gtcgtaacccacaaaatccttcggaaggccagaggaaacctggagcttaggcctggggga
gcccatccaggaacatgcagtcccagcagaccaggctcctga

DBGET integrated database retrieval system