KEGG   Homo sapiens (human): 55756Help
Entry
55756             CDS       T01001                                 

Gene name
INTS9, CPSF2L, INT9, RC74
Definition
(RefSeq) integrator complex subunit 9
  KO
K13146  integrator complex subunit 9
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    55756 (INTS9)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   Integrator complex
    55756 (INTS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lactamase_B_6 Beta-Casp Beta_lactamase3 SP2
Motif
Other DBs
NCBI-GeneID: 55756
NCBI-ProteinID: NP_060720
OMIM: 611352
HGNC: 25592
Ensembl: ENSG00000104299
Vega: OTTHUMG00000164030
Pharos: Q9NV88(Tdark)
UniProt: Q9NV88
Structure
PDB: 

Position
8p21.1
AA seq 658 aa AA seqDB search
MKLYCLSGHPTLPCNVLKFKSTTIMLDCGLDMTSTLNFLPLPLVQSPRLSNLPGWSLKDG
NAFLDKELKECSGHVFVDSVPEFCLPETELIDLSTVDVILISNYHCMMALPYITEHTGFT
GTVYATEPTVQIGRLLMEELVNFIERVPKAQSASLWKNKDIQRLLPSPLKDAVEVSTWRR
CYTMQEVNSALSKIQLVGYSQKIELFGAVQVTPLSSGYALGSSNWIIQSHYEKVSYVSGS
SLLTTHPQPMDQASLKNSDVLVLTGLTQIPTANPDGMVGEFCSNLALTVRNGGNVLVPCY
PSGVIYDLLECLYQYIDSAGLSSVPLYFISPVANSSLEFSQIFAEWLCHNKQSKVYLPEP
PFPHAELIQTNKLKHYPSIHGDFSNDFRQPCVVFTGHPSLRFGDVVHFMELWGKSSLNTV
IFTEPDFSYLEALAPYQPLAMKCIYCPIDTRLNFIQVSKLLKEVQPLHVVCPEQYTQPPP
AQSHRMDLMIDCQPPAMSYRRAEVLALPFKRRYEKIEIMPELADSLVPMEIKPGISLATV
SAVLHTKDNKHLLQPPPRPAQPTSGKKRKRVSDDVPDCKVLKPLLSGSIPVEQFVQTLEK
HGFSDIKVEDTAKGHIVLLQEAETLIQIEEDSTHIICDNDEMLRVRLRDLVLKFLQKF
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtattgcctgtcagggcacccaaccttaccatgcaatgtgctcaaattcaaa
tcaaccaccattatgttggactgcggactggacatgacttctaccctcaatttccttcct
ttgccacttgttcaaagtcccaggctgtccaatcttcctggctggtccctgaaggatgga
aatgctttcttggacaaggagctaaaggagtgctcgggtcatgtatttgtggattctgtg
ccggaattctgtttaccagagacggagctaatagatctgtctacagtagatgtgattctc
atctctaactatcactgtatgatggcgctgccatacatcaccgagcacaccggcttcaca
ggcacagtgtatgccacggaacccaccgtccagatcggcaggcttctcatggaagagctg
gtgaatttcattgaaagagtgccaaaggctcagtctgcctccttgtggaagaataaggac
attcagaggctgttaccttctcctctcaaggatgcagtggaagtctcaacctggagaaga
tgctatacaatgcaagaggtgaactctgcccttagtaaaatccagctggtgggatattct
cagaaaattgagctttttggtgcggtccaggtgactcctctgagctctggctatgccctt
gggagctccaactggatcatccagtctcattacgagaaagtgtcttatgtctctggatcc
tccttgcttaccacacacccccagcccatggaccaagcttctctcaaaaacagcgatgtt
cttgttctgacagggcttacccagatccccactgcaaacccagatggaatggtgggagag
ttctgcagcaacctagctctgacagtccggaatggaggaaacgtgttggttccctgctac
ccttctggagtgatctatgacctcctggagtgcctatatcagtacatcgactcagccggg
ctttccagcgtccccctctacttcatctcccctgtggccaacagttcactggagttttcc
cagatctttgctgagtggctttgtcacaacaaacagagtaaggtgtatcttccagaacca
ccttttcctcatgcagagctcattcagaccaataagctgaagcactaccccagcatccac
ggagacttcagcaacgactttagacagccctgtgtggtgttcaccgggcacccttccctc
cgcttcggggacgtggtccacttcatggagctctggggaaaatctagtctcaataccgtc
atattcacggaaccagacttctcctacctggaagccctggctccttaccagccgctggcc
atgaaatgcatctactgccccatcgacacccggctgaacttcatccaggtgtcaaagctg
cttaaagaagtgcagcccctgcacgtggtgtgtcctgagcagtacactcagccgccccca
gcccagtcccacaggatggacctcatgatcgactgccagccccccgccatgtcctatcgg
cgggctgaggttctcgccctgcccttcaaacgtcggtacgagaagatcgagatcatgcca
gagctcgcagattcactggtgcccatggagatcaagcctggcatctccttggcaactgtc
tcggccgtgctgcacaccaaagataacaagcacttgcttcagccccctcctcggcccgcc
cagcccacgagcgggaagaagagaaagcgggtgagcgatgacgtaccagactgcaaagtc
ctgaagcctttgttgagcggttccatccctgtggagcagttcgtgcagaccctggagaag
catggcttcagtgatattaaggtggaggacacagccaagggccatatcgtcctgctccag
gaggctgagacgctcatccagattgaagaagactcgacccatatcatctgcgacaatgac
gagatgctcagagtgcgactgcgggaccttgtcctcaaattcttacagaagttctga

DBGET integrated database retrieval system