KEGG   Homo sapiens (human): 55757
Entry
55757             CDS       T01001                                 

Symbol
UGGT2, HUGT2, UGCGL2, UGT2
Name
(RefSeq) UDP-glucose glycoprotein glucosyltransferase 2
  KO
K11718  UDP-glucose:glycoprotein glucosyltransferase [EC:2.4.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    55757 (UGGT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    55757 (UGGT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     55757 (UGGT2)
Glycosyltransferases [BR:hsa01003]
 Others
  Quality control
   55757 (UGGT2)
SSDB
Motif
Pfam: Glyco_transf_24 Thioredoxin_15 Thioredoxin_14 Thioredoxin_12 Thioredoxin_13 UDP-g_GGTase Glyco_transf_8
Other DBs
NCBI-GeneID: 55757
NCBI-ProteinID: NP_064506
OMIM: 605898
HGNC: 15664
Ensembl: ENSG00000102595
Vega: OTTHUMG00000017230
Pharos: Q9NYU1(Tbio)
UniProt: Q9NYU1 Q05D90
Position
13q32.1
AA seq 1516 aa
MAPAKATNVVRLLLGSTALWLSQLGSGTVAASKSVTAHLAAKWPETPLLLEASEFMAEES
NEKFWQFLETVQELAIYKQTESDYSYYNLILKKAGQFLDNLHINLLKFAFSIRAYSPAIQ
MFQQIAADEPPPDGCNAFVVIHKKHTCKINEIKKLLKKAASRTRPYLFKGDHKFPTNKEN
LPVVILYAEMGTRTFSAFHKVLSEKAQNEEILYVLRHYIQKPSSRKMYLSGYGVELAIKS
TEYKALDDTQVKTVTNTTVEDETETNEVQGFLFGKLKEIYSDLRDNLTAFQKYLIESNKQ
MMPLKVWELQDLSFQAASQIMSAPVYDSIKLMKDISQNFPIKARSLTRIAVNQHMREEIK
ENQKDLQVRFKIQPGDARLFINGLRVDMDVYDAFSILDMLKLEGKMMNGLRNLGINGEDM
SKFLKLNSHIWEYTYVLDIRHSSIMWINDLENDDLYITWPTSCQKLLKPVFPGSVPSIRR
NFHNLVLFIDPAQEYTLDFIKLADVFYSHEVPLRIGFVFILNTDDEVDGANDAGVALWRA
FNYIAEEFDISEAFISIVHMYQKVKKDQNILTVDNVKSVLQNTFPHANIWDILGIHSKYD
EERKAGASFYKMTGLGPLPQALYNGEPFKHEEMNIKELKMAVLQRMMDASVYLQREVFLG
TLNDRTNAIDFLMDRNNVVPRINTLILRTNQQYLNLISTSVTADVEDFSTFFFLDSQDKS
AVIAKNMYYLTQDDESIISAVTLWIIADFDKPSGRKLLFNALKHMKTSVHSRLGIIYNPT
SKINEENTAISRGILAAFLTQKNMFLRSFLGQLAKEEIATAIYSGDKIKTFLIEGMDKNA
FEKKYNTVGVNIFRTHQLFCQDVLKLRPGEMGIVSNGRFLGPLDEDFYAEDFYLLEKITF
SNLGEKIKGIVENMGINANNMSDFIMKVDALMSSVPKRASRYDVTFLRENHSVIKTNPQE
NDMFFNVIAIVDPLTREAQKMAQLLVVLGKIINMKIKLFMNCRGRLSEAPLESFYRFVLE
PELMSGANDVSSLGPVAKFLDIPESPLLILNMITPEGWLVETVHSNCDLDNIHLKDTEKT
VTAEYELEYLLLEGQCFDKVTEQPPRGLQFTLGTKNKPAVVDTIVMAHHGYFQLKANPGA
WILRLHQGKSEDIYQIVGHEGTDSQADLEDIIVVLNSFKSKILKVKVKKETDKIKEDILT
DEDEKTKGLWDSIKSFTVSLHKENKKEKDVLNIFSVASGHLYERFLRIMMLSVLRNTKTP
VKFWLLKNYLSPTFKEVIPHMAKEYGFRYELVQYRWPRWLRQQTERQRIIWGYKILFLDV
LFPLAVDKIIFVDADQIVRHDLKELRDFDLDGAPYGYTPFCDSRREMDGYRFWKTGYWAS
HLLRRKYHISALYVVDLKKFRRIGAGDRLRSQYQALSQDPNSLSNLDQDLPNNMIYQVAI
KSLPQDWLWCETWCDDESKQRAKTIDLCNNPKTKESKLKAAARIVPEWVEYDAEIRQLLD
HLENKKQDTILTHDEL
NT seq 4551 nt   +upstreamnt  +downstreamnt
atggcgccagcgaaagccacgaacgtggtgcggctgctactaggctccacagcgctgtgg
ctttcgcagctcggctccgggacggtcgccgcgtccaagtcggtgactgcccacttggcc
gcgaagtggcccgagaccccgctgctgctggaggcaagtgaatttatggcagaagaaagt
aatgaaaaattttggcagtttttggaaactgtgcaagaattagcaatttataagcaaaca
gaatcagattattcttattacaacttaatcctgaagaaagctggacagtttctagacaat
ttacacatcaaccttttaaagtttgctttctctataagggcatactccccagctattcag
atgtttcagcagattgcagctgatgagccaccaccagatggttgtaatgcatttgtggtt
attcataagaagcacacctgtaaaattaatgagattaaaaagctgctgaagaaagctgct
tcaaggactagaccttatctatttaaaggagatcacaaatttcctacaaacaaagagaac
ttaccagtggtgattctctatgccgaaatgggtactagaacatttagtgcatttcacaaa
gtattgtctgaaaaagctcaaaatgaggaaattctgtatgttcttcgccattatattcag
aaaccaagctcacggaaaatgtacttatctgggtatggtgtggagctagcaattaagagt
acagaatacaaagcactggatgatacccaagttaaaactgtgactaatactactgtagag
gatgagactgaaacaaatgaagttcaaggatttctctttgggaaactaaaagaaatatat
tcagatcttagagataatctgacagcattccaaaaatacctgattgagagtaacaaacaa
atgatgcctttgaaagtctgggaactacaagatcttagttttcaagcagcttctcaaata
atgtccgctccagtttatgattccattaaattaatgaaagacatttcacagaacttcccc
ataaaagccagatctctaaccagaattgctgtaaatcaacatatgagagaagaaataaag
gaaaatcaaaaggatcttcaagttagatttaaaattcagccaggcgatgctcgtctattt
ataaatggccttcgtgttgatatggatgtttatgacgcttttagtattttggatatgctg
aaattagaaggaaaaatgatgaatggccttcgcaatcttgggatcaatggggaagatatg
agcaaatttttaaaattaaattcacacatttgggaatatacttatgtattagatattcga
cattcttctataatgtggattaatgacttagaaaatgatgatttgtatattacatggcct
acaagttgccagaaacttctgaagccagtatttcctggaagtgtaccttccataaggcgc
aattttcataatttggttctgtttattgatccggcccaagaatataccttggattttata
aaacttgctgatgttttctattctcacgaagttcctcttagaattggttttgtgttcatt
cttaatacagatgatgaagttgatggagcaaatgatgctggagttgctctctggcgagct
ttcaactatattgcagaagaatttgatatatcagaagcatttatttctatagtacacatg
taccaaaaagtgaagaaggatcaaaatatactcactgtggacaatgtgaagagtgttctc
caaaatacatttcctcatgctaatatttgggatattttgggaattcattctaaatatgat
gaagaaagaaaggctggagcaagcttttataagatgactggcctgggtcctttgcctcaa
gctctttataatggtgaaccctttaaacatgaagagatgaatattaaagaactaaaaatg
gctgttcttcaaagaatgatggatgcatctgtatatttacaaagagaagtttttttgggc
acattaaatgatcgcacgaatgcaattgattttctaatggataggaataatgttgtaccc
cgtataaatactttgattttgcgtactaaccagcagtacctcaatttaatatctacatca
gtaactgctgatgttgaagatttctctactttctttttcttggattcacaagataagagt
gctgtaattgcaaagaacatgtattatttaacccaagacgatgagagtataatttctgca
gtcactctctggattattgcagattttgataagccttctgggagaaaacttctttttaat
gcattaaagcacatgaaaacaagtgttcatagtcggttggggattatttataatcctaca
tcaaaaataaatgaagagaacacagctatttctagaggaattttggcagcttttcttaca
cagaagaacatgtttttgagaagctttcttgggcaactggcaaaggaagaaattgctaca
gctatttactctggagataaaattaaaacattccttattgaggggatggataagaatgct
tttgagaaaaaatataatactgttggagtgaatatttttcgaactcaccagttgttctgt
caagatgtacttaaattacgtcctggagaaatgggtattgtcagcaatgggagattctta
ggacctttagatgaagatttttatgcagaagatttttacttgttggaaaagataacattt
agtaatttaggagagaaaattaaaggcattgttgaaaatatgggaatcaacgcaaataac
atgagtgactttattatgaaagttgatgcccttatgtcctctgtgcctaagcgtgcatct
cgatatgatgtcacatttcttagggagaatcacagtgttataaagacgaatcctcaagag
aatgatatgttcttcaatgtcattgctattgttgatccattaacaagagaagcacagaaa
atggcacagttgttggttgtacttggcaagattatcaacatgaagataaagttgttcatg
aactgtaggggcaggctttcagaagcccctttagaaagcttttaccgttttgttctggaa
ccagaactgatgtcaggggctaatgacgtttcttctcttggaccagtggcaaaatttttg
gatattcctgaatcacccctcctaatcctcaacatgattactccagaaggctggttggtt
gaaacagtgcacagcaactgtgaccttgataatattcacttaaaggatactgagaaaact
gttacagcagaatatgaactagaatacttactactggaaggacaatgctttgataaagtg
acagaacagcctcctcggggtctgcagttcacactaggcacaaaaaataaacctgctgtg
gttgatacaatagtgatggcacatcatgggtattttcaattaaaagcaaacccaggtgct
tggatactgaggttacaccaaggaaaatctgaagatatttatcaaatagttgggcatgaa
ggaactgactctcaagcagacctagaagatatcattgttgtattaaacagcttcaaaagc
aagatactcaaagtaaaagtgaaaaaagaaacagacaaaattaaggaagatatccttacc
gatgaagatgaaaaaacaaaaggactgtgggattccattaaaagtttcacagtaagcttg
cataaagaaaacaaaaaggaaaaagatgtcctaaacattttttcagttgcttctggtcat
ttatatgaacgttttttaagaattatgatgctttctgttttgcgtaacaccaaaacacca
gtgaaattctggttgctaaaaaattatctctcaccgacatttaaagaagtaattcctcac
atggctaaagagtatggattccgatatgaactagttcaatataggtggccccgttggctt
cgtcaacagactgaaagacagaggattatttggggttacaaaattcttttccttgatgtt
cttttcccactagcagtggacaaaatcatttttgttgatgctgaccagattgtgagacat
gatctaaaagaacttcgagatttcgatctggatggagctccttatgggtatactccattt
tgtgatagccgcagggaaatggatggatatcgtttctggaaaacaggatactgggcatca
catcttttaagacggaaataccatatcagtgctttatatgtagtggatctcaagaagttc
aggagaattggagcaggtgacaggctcaggagccagtatcaagctctcagtcaagatcca
aacagtctttcaaacctagatcaggatctccccaataatatgatttaccaagtcgccatt
aagtctcttcctcaagactggctgtggtgtgaaacctggtgtgatgatgaatccaaacaa
agagccaaaacaattgatctgtgcaataatcccaaaacaaaagaatccaaactaaaagct
gctgccagaattgtcccagaatgggtggagtatgatgctgagataagacaactattagat
catcttgaaaacaagaagcaagatacaattttgacacatgatgaactctag

KEGG   Homo sapiens (human): 56886
Entry
56886             CDS       T01001                                 

Symbol
UGGT1, HUGT1, UGCGL1, UGT1
Name
(RefSeq) UDP-glucose glycoprotein glucosyltransferase 1
  KO
K11718  UDP-glucose:glycoprotein glucosyltransferase [EC:2.4.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    56886 (UGGT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    56886 (UGGT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     56886 (UGGT1)
Glycosyltransferases [BR:hsa01003]
 Others
  Quality control
   56886 (UGGT1)
SSDB
Motif
Pfam: Glyco_transf_24 Thioredoxin_14 Thioredoxin_15 Thioredoxin_12 UDP-g_GGTase Thioredoxin_13 Glyco_transf_8
Other DBs
NCBI-GeneID: 56886
NCBI-ProteinID: NP_064505
OMIM: 605897
HGNC: 15663
Ensembl: ENSG00000136731
Vega: OTTHUMG00000131570
Pharos: Q9NYU2(Tbio)
UniProt: Q9NYU2
Position
2q14.3
AA seq 1555 aa
MGCKGDASGACAAGALPVTGVCYKMGVLVVLTVLWLFSSVKADSKAITTSLTTKWFSTPL
LLEASEFLAEDSQEKFWNFVEASQNIGSSDHDGTDYSYYHAILEAAFQFLSPLQQNLFKF
CLSLRSYSATIQAFQQIAADEPPPEGCNSFFSVHGKKTCESDTLEALLLTASERPKPLLF
KGDHRYPSSNPESPVVIFYSEIGSEEFSNFHRQLISKSNAGKINYVFRHYIFNPRKEPVY
LSGYGVELAIKSTEYKAKDDTQVKGTEVNTTVIGENDPIDEVQGFLFGKLRDLHPDLEGQ
LKELRKHLVESTNEMAPLKVWQLQDLSFQTAARILASPVELALVVMKDLSQNFPTKARAI
TKTAVSSELRTEVEENQKYFKGTLGLQPGDSALFINGLHMDLDTQDIFSLFDVLRNEARV
MEGLHRLGIEGLSLHNVLKLNIQPSEADYAVDIRSPAISWVNNLEVDSRYNSWPSSLQEL
LRPTFPGVIRQIRKNLHNMVFIVDPAHETTAELMNTAEMFLSNHIPLRIGFIFVVNDSED
VDGMQDAGVAVLRAYNYVAQEVDDYHAFQTLTHIYNKVRTGEKVKVEHVVSVLEKKYPYV
EVNSILGIDSAYDRNRKEARGYYEQTGVGPLPVVLFNGMPFEREQLDPDELETITMHKIL
ETTTFFQRAVYLGELPHDQDVVEYIMNQPNVVPRINSRILTAERDYLDLTASNNFFVDDY
ARFTILDSQGKTAAVANSMNYLTKKGMSSKEIYDDSFIRPVTFWIVGDFDSPSGRQLLYD
AIKHQKSSNNVRISMINNPAKEISYENTQISRAIWAALQTQTSNAAKNFITKMAKEGAAE
ALAAGADIAEFSVGGMDFSLFKEVFESSKMDFILSHAVYCRDVLKLKKGQRAVISNGRII
GPLEDSELFNQDDFHLLENIILKTSGQKIKSHIQQLRVEEDVASDLVMKVDALLSAQPKG
DPRIEYQFFEDRHSAIKLRPKEGETYFDVVAVVDPVTREAQRLAPLLLVLAQLINMNLRV
FMNCQSKLSDMPLKSFYRYVLEPEISFTSDNSFAKGPIAKFLDMPQSPLFTLNLNTPESW
MVESVRTPYDLDNIYLEEVDSVVAAEYELEYLLLEGHCYDITTGQPPRGLQFTLGTSANP
VIVDTIVMANLGYFQLKANPGAWILRLRKGRSEDIYRIYSHDGTDSPPDADEVVIVLNNF
KSKIIKVKVQKKADMVNEDLLSDGTSENESGFWDSFKWGFTGQKTEEVKQDKDDIINIFS
VASGHLYERFLRIMMLSVLKNTKTPVKFWFLKNYLSPTFKEFIPYMANEYNFQYELVQYK
WPRWLHQQTEKQRIIWGYKILFLDVLFPLVVDKFLFVDADQIVRTDLKELRDFNLDGAPY
GYTPFCDSRREMDGYRFWKSGYWASHLAGRKYHISALYVVDLKKFRKIAAGDRLRGQYQG
LSQDPNSLSNLDQDLPNNMIHQVPIKSLPQEWLWCETWCDDASKKRAKTIDLCNNPMTKE
PKLEAAVRIVPEWQDYDQEIKQLQIRFQKEKETGALYKEKTKEPSREGPQKREEL
NT seq 4668 nt   +upstreamnt  +downstreamnt
atgggctgcaagggagacgcgagcggtgcgtgtgccgcgggtgcgctgccggtgacagga
gtttgctataaaatgggagttctggttgtactcactgttctgtggctgttctcctcagta
aaggccgactcaaaagccattacaacctctcttacaacaaaatggttttccactccattg
ttgttagaagccagtgagtttttagcagaagacagtcaagagaaattttggaattttgta
gaagccagtcaaaatattggatcatcagatcatgacggtaccgattattcctactatcat
gcaatattggaggctgcatttcagtttctgtcacccctccagcagaatttgtttaaattt
tgtctgtcccttcgttcttactcagctacaatccaagccttccagcagatagcagctgat
gaacctccaccagaaggatgtaattcgtttttttcagtgcatggaaagaagacttgtgaa
tctgatacccttgaggctcttctactgacagcctctgaaagacccaaacctttattgttc
aaaggagatcacagatatccctcgtctaatcctgaaagccctgtggtgattttctactct
gagattggctctgaggaattttccaattttcaccgccagcttatatcaaaaagcaatgca
ggcaaaatcaattatgtattcagacattatatatttaatcccaggaaggagcctgtttac
ctctctggctatggcgtggaattggccattaagagcactgagtacaaggccaaggatgat
actcaggtgaaaggaactgaggtaaacaccacagtgattggtgaaaatgatcctattgat
gaggttcaggggttcctctttggaaaattaagagatctgcaccccgacctggagggacag
ttgaaagaactcagaaagcatcttgtagagagcaccaatgaaatggcacctttaaaggtt
tggcagttgcaagatctcagtttccagactgctgctcgaatcttggcttctcctgttgag
ttggctttggttgtcatgaaggatcttagtcagaattttcctaccaaagccagagcaata
acaaaaacagctgtgagctcagaacttagaaccgaagtggaagagaatcagaagtatttc
aagggaactttaggattacaacctggagattcagccctcttcatcaatggacttcacatg
gatttagatacacaggatatattcagtctgtttgatgtgttgaggaatgaagctcgggta
atggagggtctgcatagattgggaatagaaggcctttctctgcataatgttttgaagctg
aacatccagccctctgaggcagactatgccgtagacatccggagtcctgctatttcatgg
gtcaacaacctggaggttgatagcagatataattcgtggccttctagtttacaagagttg
cttcgacccacctttcctggtgttattcggcagatcaggaaaaacttacataatatggtt
ttcatagttgatcctgcacatgagaccacagcagagttgatgaacacagctgagatgttc
cttagtaatcatataccactaagaattggttttatctttgtggttaatgactctgaagat
gttgatgggatgcaagatgctggagtggctgttcttagagcatataattatgttgcccaa
gaagtggatgattatcatgccttccagactctgacacatatctataacaaggtgaggact
ggagaaaaagtgaaagttgaacatgtggtcagtgtcctggagaagaaatatccgtatgta
gaagtgaatagcattttggggattgattctgcttatgatcggaatcggaaggaagcaaga
ggctactatgagcagactggagttggacctctgcccgttgtgctgttcaatggaatgccc
tttgaaagggaacagctagaccctgatgagttagaaaccatcacaatgcataaaatcctg
gagaccaccaccttcttccaaagagcggtgtacttgggtgaactgccccatgatcaagat
gtggtagagtatatcatgaatcagccaaatgttgttccacgaatcaattctaggattttg
acagctgaacgagactacctggatttaacagcgagtaataacttctttgtggatgattat
gctagatttactatcttggattcccaaggcaagactgctgctgtagccaatagtatgaac
tatctgacaaagaaaggaatgtcctccaaggaaatctatgatgattcttttattaggcca
gtaactttttggattgttggggattttgatagcccttctggacggcagttactgtatgat
gccatcaaacatcagaaatccagtaacaatgttagaataagcatgatcaataatcctgcc
aaagagataagctatgagaacactcagatctccagagcaatctgggcagctctccaaact
cagacttccaacgctgctaagaacttcatcaccaaaatggccaaggagggggctgcagag
gccctggctgcaggagctgacattgcggagttctctgttgggggaatggatttcagtctt
tttaaagaggtctttgagtcttccaaaatggatttcattttgtctcatgccgtgtactgc
agggatgttctgaagctgaagaagggacagagggcagtgatcagcaatggaaggatcatt
gggccactggaggatagtgagctctttaatcaagacgatttccacctcctcgaaaatatc
atcttaaaaacctcaggacagaaaataaaatctcatattcaacagcttcgggtagaagaa
gatgtggcaagcgacttggtaatgaaggtggatgctcttctgtcagcgcaaccaaaagga
gatccaagaatcgagtaccagttttttgaagacagacacagtgcaatcaaactgaggccg
aaggaaggggagacatactttgatgttgtggctgtcgttgaccctgtcaccagagaagca
cagagacttgctcctttgctcttggttttggctcagctgataaacatgaatctgagagta
tttatgaactgccaatccaaactttctgacatgcctttaaaaagcttttaccgttatgtc
ttagaaccagagatttctttcacttcagacaatagttttgctaagggtccaatcgcaaaa
tttttggatatgcctcagtctccactgttcactctgaatttgaacacacctgagagctgg
atggtagaatctgtcagaacaccatatgatcttgataatatttatttagaagaggtggac
agtgtagtggctgctgagtatgagctggaatacctgttactggaaggtcattgctacgac
atcaccacaggccagcctccacggggactacagtttaccttaggaacttcagccaacccg
gtcattgtggacaccattgttatggccaatctgggctactttcagctgaaagccaaccca
ggagcttggatcctcagacttaggaagggacgctctgaagatatttatagaatttacagc
cacgatggcactgattctccccctgatgctgatgaggtggttatcgtcctcaacaacttc
aaaagcaaaattattaaagtgaaggttcagaagaaggcagatatggtgaacgaagacttg
ctgagtgatggaacgagtgagaatgaatctggattttgggattccttcaaatggggcttt
acaggacagaagactgaggaagtgaagcaagataaagatgacataattaatattttctcc
gttgcatctggtcatctctacgaaagatttcttcgcataatgatgctatccgtgctgaag
aataccaagactcctgtgaaattctggttcttgaagaattacttgtcccccacatttaag
gagtttataccttacatggcaaatgaatacaatttccagtatgagcttgttcagtacaaa
tggccccggtggcttcatcaacaaactgaaaaacagcgtatcatctggggttacaagatc
ctcttcctggatgtacttttcccactagttgttgacaagttcctgtttgtggatgctgat
cagattgtacgaacagatctgaaagagttaagagatttcaatttggatggtgctccttat
ggttacactcctttctgtgacagccgaagagaaatggacggctacaggttctggaagtca
gggtactgggccagtcatttagccgggcgaaagtatcatatcagtgcactatatgttgtg
gatctgaagaagtttaggaaaatagctgctggtgacagactcaggggacagtaccaaggt
ctgagtcaggaccctaacagcctttcaaatcttgatcaagatctgcccaataacatgatt
catcaggtgccaattaaatccctccctcaagaatggctttggtgtgaaacgtggtgtgat
gacgcctctaagaaaagggcaaaaaccattgatttgtgtaataatccgatgaccaaagag
ccgaaactggaagcagctgtgcggattgtcccggagtggcaggactacgaccaagagatc
aaacagctacagatccgctttcagaaggagaaagaaacgggagcactgtacaaagagaag
acaaaagaaccaagccgagaaggtcctcagaaacgtgaagaattatga

DBGET integrated database retrieval system