KEGG   Homo sapiens (human): 5576Help
Entry
5576              CDS       T01001                                 

Gene name
PRKAR2A, PKR2, PRKAR2
Definition
(RefSeq) protein kinase cAMP-dependent type II regulatory subunit alpha
  KO
K04739  cAMP-dependent protein kinase regulator
Organism
hsa  Homo sapiens (human)
Pathway
hsa04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    5576 (PRKAR2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: cNMP_binding RIIa
Motif
Other DBs
NCBI-GeneID: 5576
NCBI-ProteinID: NP_001308911
OMIM: 176910
HGNC: 9391
Ensembl: ENSG00000114302
Vega: OTTHUMG00000133540
Pharos: P13861(Tbio)
UniProt: P13861 A0A024R2W3 A8KAH7
Structure
PDB: 

Position
3p21.31
AA seq 404 aa AA seqDB search
MSHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPASVLPAATPRQSLG
HPPPEPGPDRVADAKGDSESEEDEDLEVPVPSRFNRRVSVCAETYNPDEEEEDTDPRVIH
PKTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFERIVKADEHVIDQGDDGDNFYVIE
RGTYDILVTKDNQTRSVGQYDNRGSFGELALMYNTPRAATIVATSEGSLWGLDRVTFRRI
IVKNNAKKRKMFESFIESVPLLKSLEVSERMKIVDVIGEKIYKDGERIITQGEKADSFYI
IESGEVSILIRSRTKSNKDGGNQEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCL
VMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGSSVDLGNLGQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagccacatccagatcccgccggggctcacggagctgctgcagggctacacggtggag
gtgctgcgacagcagccgcctgacctcgtcgaattcgcagtggagtacttcacccgcctg
cgcgaggcccgcgccccagcctcagtcctgcccgccgccaccccacgccagagcctgggc
caccccccgccagaacccggcccggaccgtgtcgccgacgccaaaggggacagcgagtcg
gaggaggacgaggacttggaagttccagttcctagcagatttaatagacgagtatcagtc
tgtgctgagacctataaccctgatgaggaagaggaagatacagatccaagggtgattcat
cctaaaactgatgaacagagatgcagacttcaggaagcttgcaaagatattctccttttc
aaaaatcttgatcaggaacagctttctcaagttctcgatgccatgtttgaaaggatagtc
aaagctgatgagcatgtcattgaccaaggagatgatggagacaacttttatgtcatagaa
cggggaacttatgacattttagtaacaaaagataatcaaacccgctctgttggtcaatat
gacaaccgtggcagttttggagaactagctctgatgtacaacaccccgagagctgctacc
attgttgctacctcagaaggctccctttggggactggaccgggtgacttttagaagaatc
atagtgaaaaataatgcaaagaagaggaagatgtttgaatcatttattgagtctgtgccc
ctccttaaatcactagaggtgtcagaacgaatgaagattgtggatgtaataggagagaag
atctataaggatggagaacgcataatcactcagggtgaaaaggctgatagcttttacatc
atagagtctggcgaagtgagcatcttgattagaagcaggactaaatcaaacaaggatggt
gggaaccaggaggtcgagattgcccgctgccataaggggcagtactttggagagcttgcc
ctggtcaccaacaaacccagagctgcctcagcttatgcagttggagatgtcaaatgctta
gttatggatgtacaagcattcgagaggcttctggggccctgcatggacatcatgaagagg
aacatctcacactatgaggaacagctggtgaagatgtttggctccagcgtggatctgggc
aacctcgggcagtag

DBGET integrated database retrieval system