KEGG   Homo sapiens (human): 55763Help
Entry
55763             CDS       T01001                                 

Gene name
EXOC1, BM-102, SEC3, SEC3L1, SEC3P
Definition
(RefSeq) exocyst complex component 1
  KO
K19983  exocyst complex component 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    55763 (EXOC1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Tethering complex
   Exocyst complex
    55763 (EXOC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec3_C Sec3-PIP2_bind FlaC_arch
Motif
Other DBs
NCBI-GeneID: 55763
NCBI-ProteinID: NP_001020095
OMIM: 607879
HGNC: 30380
Ensembl: ENSG00000090989
Vega: OTTHUMG00000102165
Pharos: Q9NV70(Tbio)
UniProt: Q9NV70 A0A024RDA9
Position
4q12
AA seq 894 aa AA seqDB search
MTAIKHALQRDIFTPNDERLLSIVNVCKAGKKKKNCFLCATVTTERPVQVKVVKVKKSDK
GDFYKRQIAWALRDLAVVDAKDAIKENPEFDLHFEKIYKWVASSTAEKNAFISCIWKLNQ
RYLRKKIDFVNVSSQLLEESVPSGENQSVTGGDEEVVDEYQELNAREEQDIEIMMEGCEY
AISNAEAFAEKLSRELQVLDGANIQSIMASEKQVNILMKLLDEALKEVDQIELKLSSYEE
MLQSVKEQMDQISESNHLIHLSNTNNVKLLSEIEFLVNHMDLAKGHIKALQEGDLASSRG
IEACTNAADALLQCMNVALRPGHDLLLAVKQQQQRFSDLRELFARRLASHLNNVFVQQGH
DQSSTLAQHSVELTLPNHHPFHRDLLRYAKLMEWLKSTDYGKYEGLTKNYMDYLSRLYER
EIKDFFEVAKIKMTGTTKESKKFATLPRKESAVKQETESLHGSSGKLTGSTSSLNKLSVQ
SSGNRRSQSSSLLDMGNMSASDLDVADRTKFDKIFEQVLSELEPLCLAEQDFISKFFKLQ
QHQSMPGTMAEAEDLDGGTLSRQHNCGTPLPVSSEKDMIRQMMIKIFRCIEPELNNLIAL
GDKIDSFNSLYMLVKMSHHVWTAQNVDPASFLSTTLGNVLVTVKRNFDKCISNQIRQMEE
VKISKKSKVGILPFVAEFEEFAGLAESIFKNAERRGDLDKAYTKLIRGVFVNVEKVANES
QKTPRDVVMMENFHHIFATLSRLKISCLEAEKKEAKQKYTDHLQSYVIYSLGQPLEKLNH
FFEGVEARVAQGIREEEVSYQLAFNKQELRKVIKEYPGKEVKKGLDNLYKKVDKHLCEEE
NLLQVVWHSMQDEFIRQYKHFEGLIARCYPGSGVTMEFTIQDILDYCSSIAQSH
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atgacagcaatcaagcatgcattacaaagagacatttttacaccaaatgatgaacgcctg
ctgagcattgtgaatgtctgcaaagcaggaaaaaagaaaaagaactgttttttatgtgcc
acagtgacaactgaacgccctgtgcaggttaaggtggtcaaagtcaagaaatccgataag
ggagatttctacaaaaggcagattgcatgggcccttcgagatcttgctgtggtagatgcc
aaagatgctatcaaagaaaatcctgaatttgatttacactttgaaaaaatatataaatgg
gttgccagcagcactgctgaaaagaatgcatttatttcatgcatttggaaattgaatcag
cgatatctccggaagaaaattgattttgtcaatgttagctcacagcttttggaagaatct
gttccaagtggagaaaatcagagtgtgacaggaggtgatgaagaagtagtagatgaatac
caagagttaaatgcaagagaagaacaggatatcgaaataatgatggaaggctgtgaatat
gcaatctcgaatgcggaagcctttgcagaaaaattgtccagagagctgcaggtgctagat
ggggctaacatccagtcaatcatggcatctgaaaaacaagtcaacatcctgatgaaattg
ctagatgaggctctaaaggaggtagatcagattgaattgaaactgagcagttatgaggaa
atgctccaaagtgtaaaagaacaaatggatcagatctctgaaagcaaccacctaattcat
cttagtaacactaataatgtaaaactcctatctgagatagagttccttgtgaaccacatg
gacttggccaaaggtcatataaaggcccttcaggaaggagatcttgcttcttccagaggc
attgaggcctgcaccaatgctgctgatgcccttctgcagtgcatgaatgtagctcttcga
ccaggccatgacttgcttctggcagtcaaacagcaacagcagcgattcagtgatttgcga
gagctttttgcccggagactggccagtcacctcaacaatgtttttgttcaacagggtcat
gatcagagttcgactcttgcccaacactctgttgaactgactttacccaatcatcatcca
tttcatagagatttgctccgatatgccaagctgatggagtggctaaagagtacagattat
ggaaaatatgaaggactaacaaagaattacatggattatttatcccgactatatgaaaga
gaaatcaaagatttctttgaagttgcaaagatcaagatgactggcacaactaaagaaagc
aagaagtttgctacactgcctcgaaaagaaagtgctgtcaaacaggaaacagagagtctt
catggaagttcggggaaattaactggatctacttctagtctaaataagctcagtgttcag
agttcagggaatcgcagatctcagtcatcttccctgttggatatgggaaacatgtctgcc
tctgatctcgatgttgctgacaggaccaaatttgataagatctttgaacaggtactaagt
gaactggagcccctatgtctggcagaacaggacttcataagtaaatttttcaaactacag
caacatcaaagtatgcctggaactatggctgaagcagaggacctggatggaggaacatta
tcacggcaacataattgtggcacaccactgcctgtttcatctgagaaagatatgatccgc
caaatgatgattaaaatatttcgctgcattgagccagagctgaacaacctaattgcatta
ggagacaaaattgatagctttaactctctttatatgttagtcaaaatgagtcatcatgtg
tggactgcacaaaatgtggaccctgcttctttcctaagtactacattgggaaatgttttg
gtgactgtcaaaaggaactttgacaaatgcattagtaaccaaataaggcaaatggaagaa
gtaaagatctcaaaaaagagtaaagttggaattcttccatttgttgctgaatttgaagaa
tttgctggacttgcagaatcaatcttcaaaaatgctgagcgtcgtggagacctggataaa
gcatacaccaaacttatcagaggagtatttgttaatgtggagaaagtagcaaatgaaagc
cagaagacccccagggatgtggttatgatggaaaactttcaccatatttttgcaactctt
tctcgattgaaaatctcatgtctagaagcagaaaaaaaagaagccaaacaaaaatacaca
gatcaccttcagtcttatgtcatttactctttaggacaacctcttgaaaaactaaatcat
ttctttgaaggtgttgaagctcgcgtggcacagggcataagggaggaggaagtaagttac
caacttgcatttaacaaacaagaacttcgtaaagtcattaaggagtaccctggaaaggaa
gtaaaaaaaggtctagataacctctacaagaaagttgataaacatttatgtgaagaagag
aacttacttcaggtggtgtggcactccatgcaagatgaatttatacgccagtataagcac
tttgaaggtttgatagctcgctgttatcctggatctggtgttacaatggaattcactatt
caggacattctggattattgttccagcattgcacagtcccactaa

DBGET integrated database retrieval system