KEGG   Homo sapiens (human): 55766Help
Entry
55766             CDS       T01001                                 

Gene name
H2AFJ, H2AJ
Definition
(RefSeq) H2A histone family member J
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    55766 (H2AFJ)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    55766 (H2AFJ)
  09165 Substance dependence
   05034 Alcoholism
    55766 (H2AFJ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    55766 (H2AFJ)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    55766 (H2AFJ)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    55766 (H2AFJ)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   55766 (H2AFJ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Motif
Other DBs
NCBI-GeneID: 55766
NCBI-ProteinID: NP_808760
HGNC: 14456
Ensembl: ENSG00000246705
Vega: OTTHUMG00000168736
Pharos: Q9BTM1(Tbio)
UniProt: Q9BTM1 A0A024RAS2
Position
12p12.3
AA seq 129 aa AA seqDB search
MSGRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK
TESQKTKSK
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgtccggtcgcgggaaacagggcggcaaagtgcgagcaaaggccaaatcccgctcctcc
cgcgcgggcctgcagttcccggtgggccgagtgcacagactgctgcgcaaagggaactac
gcggagcgagtgggcgccggggcgccggtgtacctggcggcggtgttggagtaccttacg
gcggagatcctggagctggctggcaacgccgcgcgtgacaacaagaagaccaggataatt
ccccgccacctgcagctcgccatccgcaacgacgaggagttaaacaagctgctgggcaaa
gtgaccatcgctcagggcggcgtcctgcccaacatccaggccgtgctgctgcccaagaag
acggagagtcagaagacgaagagcaaatga

DBGET integrated database retrieval system