KEGG   Homo sapiens (human): 55773Help
Entry
55773             CDS       T01001                                 

Gene name
TBC1D23, NS4ATP1, PCH11
Definition
(RefSeq) TBC1 domain family member 23
  KO
K22555  TBC1 domain family member 23
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    55773 (TBC1D23)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    55773 (TBC1D23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RabGAP-TBC Rhodanese
Motif
Other DBs
NCBI-GeneID: 55773
NCBI-ProteinID: NP_001186127
OMIM: 617687
HGNC: 25622
Ensembl: ENSG00000036054
Vega: OTTHUMG00000159067
Pharos: Q9NUY8(Tdark)
UniProt: Q9NUY8
Position
3q12.1-q12.2
AA seq 699 aa AA seqDB search
MAEGEDVPPLPTSSGDGWEKDLEEALEAGGCDLETLRNIIQGRPLPADLRAKVWKIALNV
AGKGDSLASWDGILDLPEQNTIHKDCLQFIDQLSVPEEKAAELLLDIESVITFYCKSRNI
KYSTSLSWIHLLKPLVHLQLPRSDLYNCFYAIMNKYIPRDCSQKGRPFHLFRLLIQYHEP
ELCSYLDTKKITPDSYALNWLGSLFACYCSTEVTQAIWDGYLQQADPFFIYFLMLIILVN
AKEVILTQESDSKEEVIKFLENTPSSLNIEDIEDLFSLAQYYCSKTPASFRKDNHHLFGS
TLLGIKDDDADLSQALCLAISVSEILQANQLQGEGVRFFVVDCRPAEQYNAGHLSTAFHL
DSDLMLQNPSEFAQSVKSLLEAQKQSIESGSIAGGEHLCFMGSGREEEDMYMNMVLAHFL
QKNKEYVSIASGGFMALQQHLADINVDGPENGYGHWIASTSGSRSSINSVDGESPNGSSD
RGMKSLVNKMTVALKTKSVNVREKVISFIENTSTPVDRMSFNLPWPDRSCTERHVSSSDR
VGKPYRGVKPVFSIGDEEEYDTDEIDSSSMSDDDRKEVVNIQTWINKPDVKHHFPCKEVK
ESGHMFPSHLLVTATHMYCLREIVSRKGLAYIQSRQALNSVVKITSKKKHPELITFKYGN
SSASGIEILAIERYLIPNAGDATKAIKQQIMKVLDALES
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaggagaagatgtgccgccgctgccaacgtcgagcggcgacggctgggaaaaa
gatcttgaagaagctctggaagcaggaggttgtgatcttgaaacgttgagaaatataatt
caaggaagaccgctgcctgctgatctgagggccaaagtttggaagattgctctgaatgtt
gcaggaaaaggtgatagtttggcatcatgggatggtattttagacttgccagaacagaac
actattcacaaagattgcctgcagtttattgaccagctttcagtgccagaggagaaggca
gcagaattacttttggatattgaatctgtaattaccttttattgtaaatcacgtaacatt
aaatatagcacatcccttagctggatacatctactgaaaccattggtgcatcttcaactg
ccacgcagcgatttatacaactgcttttatgccataatgaataagtacattcccagggat
tgttcccagaaagggagaccatttcatctcttcaggttgctcatccaataccatgagcct
gagctttgttcttatcttgatacaaagaaaattactccagactcctatgcactcaactgg
cttggaagtctttttgcatgttactgttccactgaagtcactcaggcaatatgggatgga
tatctacaacaagcagatccattttttatttatttcttaatgttaattatccttgttaat
gcaaaagaagttattttaacacaagagtcagacagcaaagaagaagttatcaagttcttg
gaaaatactccatccagtctgaatatagaagatatagaagaccttttctctctggctcag
tattattgcagcaaaacaccggcttcttttaggaaggataatcaccatctctttggtagt
actttgttgggaattaaggatgatgatgcagatctgagtcaggctctttgtctggccatc
tccgtgtcagagatccttcaagcgaatcagctacaaggggaaggagtccggttctttgtg
gtggattgccgtcctgcagaacaatataatgctgggcatttatcaactgctttccactta
gattcagacctgatgcttcagaatccatctgagtttgcacagtcagtaaaatccttgctg
gaagcacagaagcagtccattgagtctggctccatagctggtggggagcacctctgtttt
atgggcagtggcagggaggaagaagacatgtatatgaacatggtcctggcacacttttta
cagaaaaacaaagaatatgtgagtattgccagtggaggatttatggcactgcagcagcac
ctggcagacattaatgtggatggaccagaaaatggatatggccattggattgctagtacc
tcaggctcaaggagcagtatcaattctgttgatggtgaatctcctaatggctcaagtgat
agaggaatgaaatcactagtaaataaaatgactgtggctttgaagacaaaatccgttaat
gtcagggaaaaagttatcagttttatagagaatacatcaactcctgtggatcgaatgtct
ttcaatcttccttggccagacagatcatgtacagagcggcatgtgagcagcagtgacaga
gtgggcaagccttaccgtggcgtaaagcctgttttcagcattggggatgaagaagaatac
gacacagatgaaattgacagttcttcaatgtcagatgatgatagaaaagaggttgtaaac
attcagacttggataaacaaaccagatgtcaaacatcattttccttgtaaagaagtaaaa
gaaagtggacacatgtttcccagtcatctgttggttactgcaacacatatgtactgttta
agggagattgtttcacggaaaggattggcttatatacagtctcgacaagcgctgaattct
gtagttaaaattacatccaaaaaaaaacatcctgaactcattaccttcaagtatggaaat
agcagtgcttcaggaatagaaatcttggcaatcgaaaggtatttgattccaaatgcaggg
gatgcaactaaagccataaaacagcagatcatgaaagttttggatgctttggaaagttaa

DBGET integrated database retrieval system